KEGG   Yersinia pestis Z176003: YPZ3_2326Help
Entry
YPZ3_2326         CDS       T01210                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ypz  Yersinia pestis Z176003
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YPZ3_2326
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    YPZ3_2326
Enzymes [BR:ypz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YPZ3_2326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3017664..3019727
Genome map
AA seq 687 aa AA seqDB search
MKTLSAANLRGQIIPTPLDVKVYPQDADLSLGVALELSALPKPASDAIQQRFELLGLALS
ATGYPIKTVIQPTAFNGDHAVSGAYELKIGEKGAEVIGFDQVGVFYGLQSILSLVPIEGS
KTIATLDAKDAPRFDYRGVSLDVGRNFKTKAAVLRLLDQMSAYKLNKFHFHLSDDEGWRI
EIPGLPELTDVGSQRCHDLTETTCLLPQLGSGPESNNLGSGYFTRADYIDILKYAKARQI
DVIPEIDIPAHARAAVVSMEARYNNLMKQGKEKEANEFRLVDPTDDSNTTSVQFYERKSY
LNPCLDSSKHFVDKVIGEMAKMHKEAGMPLTTWHFGGDEAKNIRLGAGYQDKNGKIEPGK
GIIDMRVEDKPWAKSQVCQDMVKQGKVQDIAHLSSYFAIEVSKLVNAHGIEKMQAWQDGL
RDAKDASAFATKRVGVNFWDTLYWGGADSVNDWANKGYEVIASNPDYVYFDMPYEVNPSE
RGYYWATRFSDEAKVFSFAPDNMPQNAETSVDRDGNHFSAKSDKPWPGVQGISGQSWNET
VRTDEQMEYMAFPRVLPLAERAWHRASWEQEYKAGREYKGGETQWVDTQALSTDWQRFAN
IMGQRELAKLDKAGVAYRLPVPGARVVAGQLEANISLPGLLIEYSTDGGKKWQQYDAKAQ
PTVSGEVMIRSTSPDGKRSSRAEPVNI
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacactctctgcggctaacctgcgtgggcagattatcccaacaccactggacgtt
aaggtttatccgcaagatgccgatctgagcctcggtgtggcgctggaattgagtgcgcta
cccaaaccggcctctgatgccatacagcaacgttttgaattgctgggcctggcgctaagc
gcgacgggctatccgattaaaacagtgattcagccaacggccttcaacggggatcacgct
gtttccggtgcgtatgaactgaaaattggtgagaagggcgcagaggtgattggttttgat
caggtcggtgtattctatggcctgcaatctatcctttccttggtacctattgaggggagc
aaaacaatagccacccttgatgcgaaagatgcgccacgctttgactaccgtggtgtctcg
ctcgatgtggggcgtaacttcaaaaccaaagcggcggtcctacgtttattggatcaaatg
tctgcttacaaactgaataaattccacttccatctgagtgatgatgaaggctggcgcatt
gagatccctggcctgcctgaattgaccgatgtcggcagccagcgttgccatgatttgact
gaaaccacctgtttgctaccacagctaggctctggccctgagagcaataatctggggagc
ggttatttcactcgcgctgattacatcgatattctgaaatatgccaaagcgcgccagatt
gatgtcattcctgagatagatatcccggctcacgcccgtgctgctgtggtatcgatggaa
gcgcgttataacaatttgatgaaacagggtaaagagaaagaagccaatgaattccgtctg
gttgatccgaccgatgactcgaataccacatcagtacagttctatgagcgtaaaagttac
ctgaatccctgcctggactcttctaagcattttgtcgacaaagtcattggtgaaatggcg
aagatgcacaaagaggccggtatgccgctgaccacctggcatttcgggggcgatgaggcg
aagaacatccgtctgggggcgggttatcaggataagaatggcaaaattgagccaggtaaa
ggcatcatcgatatgcgcgttgaagataaaccgtgggcgaaatctcaggtttgtcaggac
atggtcaagcaaggcaaagttcaagatattgctcatctttccagctacttcgccattgaa
gtcagcaaactggttaatgcgcacggtatcgaaaaaatgcaggcctggcaggatggactg
agagatgccaaagatgcgagcgcgtttgctaccaagcgtgttggcgtcaacttctgggat
accctctactggggcggagcggactccgtcaacgattgggccaataaaggttatgaagtc
attgcctcgaatccagattatgtctacttcgatatgccgtatgaagttaacccaagtgaa
cgcggttactactgggcgacgcgctttagcgatgaagccaaggtgttcagcttcgcacct
gacaacatgccacagaacgccgaaacctcggttgatcgcgatggtaatcatttcagtgcg
aagagtgataaaccctggccgggtgtacagggtatctccggtcagtcttggaatgaaacg
gtacggactgatgagcagatggagtacatggccttccctcgtgtattaccgctggctgag
cgtgcatggcatcgcgcatcctgggagcaggagtataaagcggggcgtgaatataaaggt
ggcgagactcagtgggtcgatactcaggcattaagcacggattggcagcgtttcgctaac
attatggggcaacgtgaactggcaaaactggataaagcgggtgtggcttaccgcttgcca
gtaccgggggccagagtggtggcggggcagttggaagccaatatttccttgccaggcctc
cttatcgagtactccactgatggaggcaaaaaatggcagcagtatgatgctaaagcgcaa
cctactgtcagcggtgaagtgatgatccgttccaccagcccagacggtaagcgcagtagc
cgtgcggagccagttaacatctga

DBGET integrated database retrieval system