KEGG   Yersinia pestis Z176003: YPZ3_2714Help
Entry
YPZ3_2714         CDS       T01210                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypz  Yersinia pestis Z176003
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YPZ3_2714
Enzymes [BR:ypz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YPZ3_2714
   3.1.2  Thioester hydrolases
    3.1.2.-  
     YPZ3_2714
Lipid biosynthesis proteins [BR:ypz01004]
 Fatty acid synthase
  Component type
   YPZ3_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3490854..3491489
Genome map
AA seq 211 aa AA seqDB search
MNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQAT
PSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDLSEI
INQITAAKAQPLLMQIRIPPNYGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEWM
QDDGLHPNGDAQPFIADWMAQQLKPLVVDPK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaacgttttccgctggcatcttcccttccttttactgttgggattattc
agtttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgccggt
taccgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagccacg
ccttcattaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaagggcta
gcgcgcttacccgctctactcaaacaacatcagccacgctgggtgctgattgaactgggc
gccaatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatctgagcgaaatt
atcaatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattccccct
aactatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaacag
ttcgacatccccctactccctttttttatggaacaggttgccgttaagccagagtggatg
caggatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatggcg
caacaactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system