KEGG   Yersinia pestis Z176003: YPZ3_2749Help
Entry
YPZ3_2749         CDS       T01210                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ypz  Yersinia pestis Z176003
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ypz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3532364..3532939)
Genome map
AA seq 191 aa AA seqDB search
MEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEHCT
ICLNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGPGDIGLDLLEK
RLSTEAISEVILATNPTVEGDATANYIGQMCGQYGILASRIAHGVPVGGELEMVDGTTLS
HSLAGRNPIKY
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgttgcgttgtttaccgggtgttggcccgaaatcggcgcaacgtatggcattt
cagctattacagcgcgatcgtagtggtggaatgcgcctggcgcaggctctgacacgggca
atgtctgaaataggccattgtgcagattgtcgtacatttaccgagcaagagcactgcacc
atctgcttgaatccccgccgtcaacaaaatggtcaaatctgtgtggtcgaaagcccggca
gatatccatgccattgagcaaactggccagtttggcgggcgttattttgtgctgatgggg
catttatcacctatggatggtattggccctggtgatatagggctagatctactggagaaa
cggctttctactgaggctatcagtgaggtcattttagccacgaatccaaccgttgaaggg
gatgcaacagccaactatatcggccagatgtgtggccaatatggcatactggccagccgc
atcgcccatggcgttcctgttggtggcgagttagaaatggttgatggcaccacgttatct
cactcgttagcagggcgtaatcccatcaagtactga

DBGET integrated database retrieval system