KEGG   Yersinia pestis Z176003: YPZ3_2915Help
Entry
YPZ3_2915         CDS       T01210                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ypz  Yersinia pestis Z176003
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ypz00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3743954..3745441)
Genome map
AA seq 495 aa AA seqDB search
MSTPIILAIDEGTTNAKAIAVDRAGRVLAKASVPLQLEHPQPGWAEQDPLAIWLAVSQAV
EGCLNQLAGAQVAGIAISNQRESVLIWERETGTPLTPVVSWQCRRSEAFCLALRQLPAAA
MVAERTGLQIDPLFPAAKIHGMLAQIPHGAERAAHGELCVGTLDCWLTWQFSEGQSFSTD
FSNAARTQLFNIHSGQWDPDLLALFGIPSLCLPAVLPSASIHGHTARTGILGLEQGVPIV
AHIGDSHAALYGQGGDQAGEIKATYGTGSSLMMTLKQASAPSHGLSTTIAWHDGELRYAL
EGNITHTGSGVAWVSRMLGISDLSRLTDMAESQSGNQGVYFVPALSGLGAPYWDSQARGL
FCGLTDATTPAVLARAALESVAYQIADVFFAMENAAHHRLERLRVDGGATSNRWLMQFQA
DLLQRTLIRNHTAEVSALGAAYLGGKTLGWWQDSQQLAALPREVEYIEPRIHSAEMQDNY
SLWQTAIARARFQPK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgccaatcattctggctattgatgaagggacaaccaacgccaaagccattgcg
gtagatcgtgccgggcgagttctggcgaaagcctcggtaccattacaactggagcatcct
cagcccggttgggcagaacaggatccgctggcgatttggctggcggtttctcaggcggtt
gaggggtgcctaaatcaattggcgggcgcacaggtggcggggattgccatcagtaatcag
cgtgaatcggtactgatttgggaacgggaaaccggcacgccgctcacgccagtcgtaagc
tggcagtgccgtcgttcagaggctttctgtctggctttgcgccaattaccggctgcggcg
atggttgcggaacggactggattgcagattgatcccctgtttcctgcggctaaaattcat
ggcatgttggcgcagatccctcatggcgctgaacgtgccgctcacggtgagctgtgtgtt
ggcacgcttgattgctggctgacctggcagtttagcgaagggcaaagtttctcgactgac
ttctctaatgcggcccggacccagctgtttaatatccattcaggtcaatgggaccccgat
ttactggcgctgtttggtatcccaagtctttgcctgcccgccgtcttaccctcggcatcc
atccacggacacaccgcgcgcaccgggattctcggcctggagcagggcgtgcctatcgtg
gcacacattggtgattcgcacgccgcgctgtacgggcaaggcggcgaccaggccggtgaa
atcaaagccacttatggcaccggctcctctctgatgatgacgctaaaacaggccagtgca
ccaagccacggcctaagcaccaccattgcctggcatgacggcgaattacgttatgccctt
gaaggtaacatcacccataccggctcaggagtggcatgggtctcgcgcatgttagggatc
agtgatttgtcacgtctgactgacatggcagaaagccaatcaggtaatcaaggcgtctat
tttgtaccggcattatcaggactgggtgcgccttattgggacagtcaggcgcgtggtttg
ttctgtggtctgacggatgccacgacaccggccgtactggcgcgagcggcacttgaatca
gtcgcttatcaaatagccgatgttttctttgcgatggagaatgcggctcatcatcgcctt
gaacggctgcgggttgatggcggcgcgaccagtaatcgctggctgatgcagtttcaggcc
gatttattgcagcgcacattgatacgtaatcacacggcagaagtgtcagcactgggtgcc
gcgtatttgggcgggaaaacccttggctggtggcaggatagccaacaactggctgcgctc
ccccgtgaagtggaatacatcgaaccgcgcattcacagtgcggagatgcaagataactat
agcctctggcaaacggccatcgcgcgtgcgcgttttcagccgaaataa

DBGET integrated database retrieval system