KEGG   Yersinia pestis Z176003: YPZ3_3015Help
Entry
YPZ3_3015         CDS       T01210                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00010  Glycolysis / Gluconeogenesis
ypz00020  Citrate cycle (TCA cycle)
ypz00620  Pyruvate metabolism
ypz01100  Metabolic pathways
ypz01110  Biosynthesis of secondary metabolites
ypz01120  Microbial metabolism in diverse environments
ypz01130  Biosynthesis of antibiotics
ypz01200  Carbon metabolism
Module
ypz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPZ3_3015 (aceF)
   00020 Citrate cycle (TCA cycle)
    YPZ3_3015 (aceF)
   00620 Pyruvate metabolism
    YPZ3_3015 (aceF)
Enzymes [BR:ypz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YPZ3_3015 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA Ifi-6-16
Motif
Other DBs
NCBI-ProteinID: ADE65924
Position
complement(3869366..3870895)
Genome map
AA seq 509 aa AA seqDB search
MSIEINVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDKVATGSLIMVFDATGAAAAPVKAEEKPAAPAQVAAPAASAAKNVEVPDIGDDEVEVT
EVMVKVGDKVDAEQSLITVEGDKASMEVPAPFAGIVKEIKISTGDKVKTGSLIMVFEVEG
AAPAPAAAPAAKAESKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDI
QAYVKDAVKRAEAAPAAAGGGLPGILPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWV
MIPHVTQFDEADITEVEAFRKQQNIEAEKKKQDLKITPLVFLMKAAAKALEEFPRFNSSI
SEDGQKLTLKKYINIGVAVDTPNGLVVPVFRDVNKKGIVELSRELSVISKKARDGKLTAS
DMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNGKEFAPRLMLPLSLSF
DHRVIDGAAGARFAAYIATIMADIRRLVM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagaaattaatgtaccagacatcggtgcagatgaagtggaagtcaccgaaatt
atggtgaaagtgggcgataccgttgaagcggaacagtcgctaatcaccgttgaaggcgat
aaagcttccatggaagttccttcacctcaggcgggcgtggttaaagagatcaaaattgcg
gttggcgataaagtggctaccggttctctgatcatggtcttcgacgctacgggtgccgct
gcggcaccggttaaagcagaagaaaaaccggcggcgcctgctcaggtagcggctccggca
gcctctgcggcgaaaaatgttgaagtgccagatatcggtgatgacgaagttgaagtgact
gaagtgatggtgaaagtgggcgataaagttgacgccgaacaatcactgattacggttgaa
ggcgacaaagcgtcgatggaagtgcccgcaccgtttgctggtatcgtgaaagaaatcaaa
atcagtaccggcgacaaagtgaaaaccggctctctgattatggtcttcgaagttgaaggt
gcagcgccagcgccagccgccgcacctgccgccaaagcagaaagcaaaggcgagtttgcc
gagaatgacgcttacgtgcatgccacgccggttatccgtcgtctggcgcgtgagttcggt
gtgaacctggcgaaggtgaaagggacaggccgtaagggccgtatcctgcgcgaagacatt
caagcttacgtgaaagatgccgtgaaacgtgccgaagctgcaccagcagcggctggcggc
ggcctgccgggcatattgccttggccaaaagttgatttcagtaaatttggtgaaatcgaa
gaagtcgaattgggccgtatccagaaaatttctggtgcgaacctgagccgtaactgggtc
atgatcccacatgtgacgcaattcgatgaagcggatatcactgaagttgaagccttccgt
aagcaacagaacatcgaagctgagaagaaaaaacaagacctgaaaatcaccccgctggtg
ttcctgatgaaggccgccgctaaagcactggaagaattcccacgctttaacagctccatt
tccgaagatggtcagaaactgacgctgaagaaatacatcaatatcggtgtggcggttgat
acgcctaacggcttggtagttccagtattccgtgacgtcaacaaaaagggtattgtcgag
ttgtctcgtgagctatctgtcatctccaagaaagcacgtgatggcaagctgacagcatct
gacatgcaaggcggctgtttcactatctccagtctgggcggtatcggcggtacggcattt
acgccaatcgtcaatgcgccagaagtggctatcttgggtgtatcaaaatcatccatgaaa
cctgtctggaatggtaaagagtttgctccacgcctgatgttaccgctgtctctgtccttc
gatcaccgtgtgattgatggtgccgcgggtgcacgcttcgccgcgtatatcgctaccatt
atggcggatattcgccgtctggtgatgtaa

DBGET integrated database retrieval system