KEGG   Yersinia pestis Z176003: YPZ3_3111Help
Entry
YPZ3_3111         CDS       T01210                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ypz  Yersinia pestis Z176003
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPZ3_3111
Enzymes [BR:ypz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YPZ3_3111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3990497..3991426)
Genome map
AA seq 309 aa AA seqDB search
MSVFILGSYAKALVMTTDRIPLAGETLIGYDFRQTWGGKGSDMAVQAVRLGAEVAYAGVV
GDDTFGHEFVGLMQEEGVNIDALTISGELPTGAGLIVKDKEARNVIVVDMGANKLFTPAL
VDSALSQLKQSNVVLTQLEIPLETARYGLQRAKEFGKITILNPAPARDLRGLDLSAIDYL
TPNETEARVALGLPPDDPRSNREIANLLLETGCQYVVMTLGESGSAVFGRNDTQEIPPCI
IDVVDSNGAGDSFNAALAVALDEGLPISEAVLFANATAALCCMDWETVPSYRYREDVDAF
MRSITVKEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatttattctcggcagctatgcgaaagcgctggtgatgaccaccgaccgtatt
cctctggctggggaaacgctgattggctatgactttcgccagacgtggggcggtaaaggc
tcggatatggcggttcaggcagtgcgtctgggggcagaggtcgcctatgcgggtgtcgtc
ggtgatgacacctttggccatgaatttgtcggcttgatgcaggaagaaggcgtcaatatc
gacgcattaaccatcagcggagaattaccaacgggggcgggacttatcgttaaagataaa
gaagcccgtaacgtgattgtcgtggatatgggggccaataaactgtttaccccagcgttg
gtggacagcgccttatcccagctcaaacaaagcaatgtggtgctcacacagcttgaaatt
ccgctggaaacggcacgttacggactccaacgggcaaaagaattcggcaaaataaccatc
ctgaacccggctccggcaagggatctgcgcggtctcgatctcagcgcgattgattatttg
acccctaatgaaacggaagcccgcgtggctctgggtctgcctccggatgacccacgcagc
aaccgagagattgccaacctcttactggaaaccggttgccaatatgtcgtgatgacgctg
ggtgaatcaggttctgcggtatttggtcgcaacgacacacaagaaatccccccctgcatc
attgatgtcgtcgacagtaacggtgcaggtgacagctttaacgcggcactggccgtcgcg
ctggatgaagggctgccgattagcgaagctgtgctgtttgctaacgccacggcggcgttg
tgctgtatggattgggaaacggttccgtcctatcgctaccgcgaagatgtcgatgctttt
atgcgatctataaccgtgaaagaggaataa

DBGET integrated database retrieval system