KEGG   Yersinia pestis Z176003: YPZ3_3258Help
Entry
YPZ3_3258         CDS       T01210                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ypz  Yersinia pestis Z176003
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4173410..4174243
Genome map
AA seq 277 aa AA seqDB search
MHLTARGLTLDLSRPQVMGILNVTPDSFSDGGCHNNLDQALQHAQRMLSAGATLIDIGGE
STRPGAAEVSEQEELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSL
QEPGALEAAAKTGLPVCLMHMQGQPKNMQHSPYYDDLMTDINRFFQHHIERCVAAGIAKN
KLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSV
ACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSAKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcatctaactgccagaggtctgacgttggatctctctcgtccacaagtcatgggtatt
ctgaatgtcacaccagattcattttcagatggtgggtgtcacaataaccttgatcaagca
ttgcaacatgctcaacggatgttatcagcaggcgctacgctgattgatatcggtggtgaa
tcaacgcgccctggggctgctgaagtcagtgagcaagaagaacttgatcgagtcgtgcct
gtggttgaggcgttagctcagcgttttgatgtgtggctctcggtagacacgtctaaagcc
gctgttatcactgaatctgctcatgcaggtgcccatctaattaatgatatccgctcgttg
caagagcctggcgctcttgaagcagcggcaaagactggcttaccggtgtgcctaatgcat
atgcaggggcaaccgaaaaatatgcagcattcaccctactatgatgatttaatgaccgat
ataaatcggttcttccaacatcatattgaacgctgtgttgcggcaggtatcgcaaaaaat
aaattgttgctcgacccaggcttcggtttcggtaaaaatctggcgcataattaccaacta
ttggcacatctgtcagagcttcaccattttgagttgccattattggtcggaatgtcgaga
aaatcgatggtaggccaattattgaatgtaccaccacaacagcgtgtcatcgggagtgtt
gcttgtgcggtgattgctgccatgcaaggtgcgcagattatcagagtgcatgatgtcaaa
gaaactgtcgaggcgatgtgtatcgtcgaggcaacacgttcagcgaagggataa

DBGET integrated database retrieval system