KEGG   Yersinia pestis Z176003: YPZ3_3324Help
Entry
YPZ3_3324         CDS       T01210                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ypz  Yersinia pestis Z176003
Pathway
ypz00071  Fatty acid degradation
ypz00280  Valine, leucine and isoleucine degradation
ypz00281  Geraniol degradation
ypz00310  Lysine degradation
ypz00362  Benzoate degradation
ypz00380  Tryptophan metabolism
ypz00410  beta-Alanine metabolism
ypz00640  Propanoate metabolism
ypz00650  Butanoate metabolism
ypz00903  Limonene and pinene degradation
ypz00930  Caprolactam degradation
ypz01040  Biosynthesis of unsaturated fatty acids
ypz01100  Metabolic pathways
ypz01110  Biosynthesis of secondary metabolites
ypz01120  Microbial metabolism in diverse environments
ypz01130  Biosynthesis of antibiotics
ypz01200  Carbon metabolism
ypz01212  Fatty acid metabolism
Module
ypz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YPZ3_3324 (fadB)
   00650 Butanoate metabolism
    YPZ3_3324 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    YPZ3_3324 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    YPZ3_3324 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPZ3_3324 (fadB)
   00310 Lysine degradation
    YPZ3_3324 (fadB)
   00380 Tryptophan metabolism
    YPZ3_3324 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPZ3_3324 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YPZ3_3324 (fadB)
   00281 Geraniol degradation
    YPZ3_3324 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YPZ3_3324 (fadB)
   00930 Caprolactam degradation
    YPZ3_3324 (fadB)
Enzymes [BR:ypz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YPZ3_3324 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YPZ3_3324 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YPZ3_3324 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     YPZ3_3324 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADE66233
Position
4275630..4277819
Genome map
AA seq 729 aa AA seqDB search
MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTKTVANLGEALNVLEKQSELKGLLLRSA
KTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCEC
ILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDALK
IGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGRV
MQVAGKHYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQYVK
AQAKKLSKGVAAPKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAAKLL
NKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEALIGE
DTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAVVAY
ATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAKGKP
RKENDEQVDKLLAEISQPLQEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDMALVY
GLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPVAAAL
LDVSTNQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaagcgaaacattacagcttcactggttggaaaacggtattgccgagttg
gtatttgatgctccgggttcagttaataaactggatactaaaaccgtagccaatttgggt
gaagccttgaatgtgttagaaaaacaaagtgaactcaaagggttgctattacgttcagcg
aagacagccttgattgttggtgccgatattactgagtttctatccctgtttaatgcccca
ccagaaaaactgcaccagtggctggtgttcgccaacaccattttcaatcgactggaagat
ttacccgtgccaaccatttcagcaattaatggatacgcactaggtggaggatgtgaatgt
attttggcgacggatttccgtatcgcctccccagaagcacgtatcggcctcccagaaacc
aagttgggcatcatgccgggcttcggtggttcggtccgtttaccacgcctgctaggcgct
gatagtgcacttgagattattgccacaggtaaagatgttactgccaacgatgcactaaag
attgggctggttgatgcagttgtcgaccctgagaaactggtcggttcagccttaactatg
ctgaaacaagctattgacggtaagctcgattggcaggcagcacgccgcccaaaactggaa
cccctaaaacttaatcctaccgaagcggctatgtgttttaccattgctaaaggcagagtc
atgcaagtcgccgggaaacactatcccgcaccattgactgcagtaaaaactattgaagcc
gccgcaaaatttggtcgtaccgaagcgctgaacttggaaaccaacagttttgtcccttta
gcgggttccaatgaagctcgcgctttggtggggatttttcttaacgaccagtatgtaaaa
gcgcaagccaaaaaactgtccaaaggcgtcgctgcaccaaaactggctgcggttctgggc
gcagggatcatgggaggtggaattgcctatcagtcagcgctgaaaagtgtgccagtcatt
atgaaagatattaatgaaaactcgctggatcttggaatgaatgaggccgctaaattactg
aataaacagctggaacgcggcaaagtggatggccttaaaatggcaagtattctagcgact
attcgaccaaccttggattatgcaggtattgaacgagcccaagtgatcgtcgaagctgtg
gtggagaacccgaaggttaaagccgctgtacttgcggaagtagaagcattaatcggtgaa
gataccgttttagcttccaatacctcgacgattcctattgatcagttggctaaatcactc
aaacgccctgaaaatttctgcggtatgcacttcttcaatccagtacaccggatgccactg
gttgaaattattcgtggggcaaaaacctcagataaaacccttgcggcagtagtcgcttac
gctacacaaatggggaaaaccccaattgttgtcaatgattgccctggtttcttcgttaac
cgcgtcttattcccgtatctcgcaggctttggcatgttagtcagagacggtggggatttc
caccaaattgataaagtgatggaaaaacagtttggctggccgatggggcccgcttatcta
ttagatgtcgtcggtattgatactgcccatcatgcacaagcggtgatggctgccggtttc
cctgagcgaatgaacaaggattaccgtgatgcggttgatgtgatgtttgataaccaacga
tttgggcaaaagaatggtcaggggttttaccgctatacgcaagatgcaaagggtaagcca
cgtaaagaaaatgacgaacaagtggataaattactggcagaaatcagccaacctctccaa
gaattcagcgatgaagacattattgcccgcaccatgatcccaatgatcaatgaagtcgtc
cgctgcctggaagaaggtattattgccagcgcagccgagggtgacatggcgctggtttat
ggccttggcttccctccattccacggaggagtcttccgttaccttgatacgctcggtagc
gcaaattatgtcgaaatggctcaacgctatgcccaccttggtgcgttatatcacgttcct
gcggggctacgagctaaagctgaacataacgaaagttattatcctgtggcagcagcgctg
cttgatgtttctaccaatcaaccagcatga

DBGET integrated database retrieval system