KEGG   Yersinia pestis Z176003: YPZ3_3404Help
Entry
YPZ3_3404         CDS       T01210                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthetase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ypz  Yersinia pestis Z176003
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YPZ3_3404 (hemD)
Enzymes [BR:ypz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     YPZ3_3404 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4367532..4368281
Genome map
AA seq 249 aa AA seqDB search
MTILVTRPSPAGEQLVTRLRALGRVAYHAPLIDFSPGRDLPKLPELLQDMQAGDLVFALS
QNAVRYANPLLKRNKLSWPVQLSYYAIGRTTALALHTASRLHVTFPPMGETSEMLLSLPL
LQNLAGKKALLLRGNGGRELLGASLAERGAAVTFCECYQRSPIYYDGSEQSAHWQRAGVD
ILVVTSGEMLQQIYTLVPDYYRSSWLLRCRLIVVSDRLAALATQMGWTEVRVAENADNDA
LIRALQDLQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcctggtcacccgtccatcccctgctggggagcaattagtcactcgcctgcgt
gctctgggccgggttgcctaccatgcgccattgattgatttttccccaggaagagacctg
cccaaactgccggaattattgcaagatatgcaagcgggagacttggtttttgctttatca
cagaacgcggtccgctacgctaacccgctgttaaaaagaaataaactgtcatggcctgtg
cagttatcttattatgctattggccgtacaaccgcattagcactgcataccgccagccgt
ttgcatgtcactttcccaccaatgggggagaccagtgaaatgctgctatcattgcccctg
ctgcaaaatttggccggtaaaaaggcactgttattacgcggtaatgggggccgggagttg
ctaggcgcaagcctcgcagaacgcggagcggccgtgaccttctgcgaatgctatcaacgc
agtcccatctattatgatggcagcgaacaaagtgctcactggcaacgtgccggtgttgat
attctggtggtcaccagcggcgaaatgttacaacagatctatactttagttcctgattac
tatcgttcttcctggttactgcgttgccgtttaatcgttgtgagtgatcgtttagcggcc
ttagccacccaaatggggtggacggaggtccgggtagcagaaaatgccgataatgacgca
ctgatccgtgcgttacaagaccttcaataa

DBGET integrated database retrieval system