KEGG   Zobellia galactanivorans: ZOBELLIA_1026Help
Entry
ZOBELLIA_1026     CDS       T01586                                 

Gene name
nahA1
Definition
(GenBank) Beta-N-acetylhexosaminidase, family GH20 (EC:3.2.1.52)
  KO
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
zga  Zobellia galactanivorans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ZOBELLIA_1026 (nahA1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ZOBELLIA_1026 (nahA1)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ZOBELLIA_1026 (nahA1)
Chaperones and folding catalysts [BR:zga03110]
 Intramolecular chaperones
  Others
   ZOBELLIA_1026 (nahA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1231605..1233908)
Genome map
AA seq 767 aa AA seqDB search
MILKKNICLSLFLLLLGALSGGAQISKVDHGNWDVLPSPTQMVKEKGYFKLNGPTLVGVA
QPELKPLAEILVAYVNRIAGADLKLAQDSENSPKILLGINEDLNENSHTIKVGRKIEIEG
QTYEAVSNAVASLVQLVEVSKKGGAIPRLVISDSPKSNFRSVMLDLARFWHPTETIKETI
DLLWLYKIKYLSLHLTDNKRFTFPLEKFPKVNKTHSDGSREFYTKEELRDLVEYAKNRGV
TIIPEIEVPGHSGILWSTYPEVFGSVDEQTKEAKPLYVVNMAKESTYSALNTIIKEVAEV
FYTSPYIHVGGDEVYLENLKKIPEYKAYTLEHNLQEAANGDANELFCHFINRMNGMVKAT
GKKTLIWEGFHGTGSKYVTVDKDITIIVWNTTYNHPQNLLDNGYKIVNSTWVPWYMVGAM
NFAPEIKKAYDWSPTKWSHWQDAIEDIEVTGDEAILGGQISFWEQNHFKVIPVLRKRVPV
LAAHLWSGSINTGYDNFLKTLEKTDQLYSRLFNPVKIEVSGLVHEEDQRFTDKITIAFQS
KEEVEFKWNFSTSWSLPNMGKAKPYEGPIDIANGGILTVQAFTASGNPLGHPQQEYYQKI
VPAYSYKVYGPISKEVGGSVPDFSELKLVREGVTGFMTSDRLDKINGELFAKVARDGHID
TRFYRLYNPYAVELNGQIYIPGNEDYTFRLTTDDGFANIYIDDKLVAKGSETNKTPQDFN
VALSEGKHTLRIEYYYRKIQNQLNIKYKTDPMHGFLPFEKLVTPLKN
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgatattgaaaaaaaacatttgtttaagtctatttttattgctcctaggagctttatcg
ggaggtgcccaaatatctaaggttgatcacggaaattgggacgtgctgcccagtccgaca
cagatggtcaaggaaaagggatattttaaactaaacggccccactttggttggtgtagcc
caacccgaattaaaaccattggcagaaattttggtcgcctatgtcaaccgcattgccgga
gcggatttaaaattggcccaagattcagaaaatagtcccaagatattactgggcataaat
gaagacctgaacgaaaactcccataccattaaagtgggtagaaaaattgaaatcgaaggg
cagacctatgaagcggtatccaatgcggtagcgagcttggttcaattggtagaggtctcc
aaaaaggggggcgcaataccacggcttgttatttccgatagcccaaaatctaattttagg
tctgtaatgctagaccttgcccgattttggcatcctacggaaactattaaggaaaccata
gacttgttgtggttgtacaagataaagtatttaagccttcatttaacggataataagcgt
tttacctttccattggagaaattcccgaaagtaaataaaacccattcggatggcagtcgc
gaattctataccaaggaagagttgagagatttggtggagtatgcaaaaaataggggggtt
accatcattcctgaaattgaggttcccggtcactcgggtattttgtggagtacctatcct
gaggtttttggcagtgtcgatgagcaaacgaaggaggcaaagcccttgtatgtggtcaat
atggccaaagagtctacctattcggccttgaatacaattataaaagaggtcgccgaggta
ttttacaccagtccgtacatacatgttggcggagatgaggtgtatttggaaaacttgaaa
aaaataccggaatacaaagcgtatacccttgaacataatttacaggaagcggccaatggc
gatgcgaatgaactcttttgccactttatcaaccgaatgaacggcatggtaaaggctacg
ggaaaaaagaccctaatttgggagggctttcacggtacgggatctaaatatgttaccgtg
gacaaagacatcacgataatcgtttggaacactacctataaccatccccaaaacctattg
gataatgggtataaaattgttaactccacctgggtgccttggtatatggtgggagccatg
aattttgccccggaaataaaaaaagcatatgattggagtccgaccaaatggtcacattgg
caagacgctattgaagatattgaggtgaccggcgatgaagcaattctaggggggcaaatt
tctttttgggagcaaaaccactttaaggttattcctgtcctaagaaagagggtgcccgtt
ttggcggcccatctttggagtggatctataaatacaggttacgataactttttaaagaca
cttgaaaagacggaccaattgtattcccgtctttttaatccggtaaaaatagaagtgagc
ggcttggtgcatgaggaagatcaacgttttaccgacaaaataaccatagcatttcagtct
aaggaggaagtagagttcaaatggaatttctcgacctcctggagcttgcccaatatgggg
aaggcaaaaccatacgagggtccaattgacattgcaaacgggggaattcttaccgtgcag
gcctttactgcatcgggaaacccattagggcatcctcagcaagagtattatcagaaaata
gtaccggcttattcttataaagtttatggccccatatcaaaagaagttgggggaagtgtg
cccgatttctcggaattgaagttggtaagggaaggggttaccggctttatgaccagtgat
cgactagataaaataaacggcgaactttttgccaaggtcgctagggatggacatatcgat
acaaggttttaccgactttataacccatatgcggttgagcttaacggacaaatttatatt
ccaggaaacgaagactatacatttaggcttacaaccgatgacggatttgccaatatctat
atcgacgataaacttgtagccaaaggaagtgagaccaacaaaactcctcaagattttaat
gtagctctttccgaaggcaagcataccttgaggatagaatattattatcgaaagattcag
aaccaattgaacataaaatataaaaccgacccaatgcacggttttctgccttttgagaaa
ttagttacccctttaaaaaattga

DBGET integrated database retrieval system