KEGG   Zobellia galactanivorans: zobellia_109Help
Entry
zobellia_109      CDS       T01586                                 

Gene name
ccpA1
Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
zga  Zobellia galactanivorans
Brite
Enzymes [BR:zga01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     zobellia_109 (ccpA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
125410..126456
Genome map
AA seq 348 aa AA seqDB search
MQKSSILVVLVTLALWSCDTSSDDYQTVNEPLEFTVPSNFPEPIYDLEANPPTTVGFELG
KKLFYDGRLSSNGFISCGFCHEQRTAFTHHGHQFSHGIDDLEGVRNTPAIQNAAFMKEFT
WDGATSHLDLFPIIPITNEVEMGETVSNVIAKIKSDDEYQKLFALAFEDEEVNTENFFKA
LSQFMVMMISADSKYDKYVRQEEGGTFTEEELEGLSVFQNKCASCHATDLFSDDAFRNNG
LAPNPTLNDIGREEVSGSPDDRYKFKVPSLRNVALTAPYMHDGRFGSLEAVLDFYSESVV
DSPTLDPILKQESSLGIPLTDNEKNVLLAFLGTLTDETYINDERFAEY
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatccagtatacttgtagtacttgtaaccttggcgttgtggtcttgtgatacg
tcctcggatgactaccagaccgttaacgaacccttggaatttacagtgccctcgaatttt
ccggagccgatctatgacttagaggcaaatcctccgactaccgtgggttttgagctgggc
aaaaagcttttctacgatggccgactgtcaagcaatgggtttatctcgtgtggattttgt
catgaacaacgtaccgctttcacacaccatggccaccaattcagccacggcatagacgac
ctcgaaggggttagaaacacccccgcgatacagaacgcggcatttatgaaagaatttacc
tgggatggcgccacaagccatttagacctatttcctataatacccattaccaatgaggtc
gaaatgggcgaaacggttagcaatgtaatcgctaaaatcaaaagcgacgacgaataccaa
aaactcttcgctctggcctttgaagatgaggaagtaaacaccgaaaactttttcaaggcc
ctctcccaatttatggtgatgatgatttcggccgattcaaagtacgataagtacgtacga
caagaagaaggcggaacatttaccgaagaagaacttgaagggctctccgttttccagaac
aaatgtgcctcttgtcacgccaccgacctttttagcgatgacgcttttagaaataacgga
ttggcccccaacccaactctcaacgacataggccgtgaagaagtgagcggctcccctgat
gaccggtacaagttcaaagtacccagtttaagaaacgtggcccttaccgctccctatatg
cacgatggaaggttcggctcactagaagccgtactcgacttttacagtgagtcggtcgta
gactcccccaccttggatcctattttaaaacaagagagcagtttaggcattcccttaact
gataatgaaaaaaatgtattgctagcctttttaggaacattaacggatgaaacttatata
aatgacgaacgatttgctgaatactag

DBGET integrated database retrieval system