KEGG   Zobellia galactanivorans: ZOBELLIA_1310Help
Entry
ZOBELLIA_1310     CDS       T01586                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
zga  Zobellia galactanivorans
Pathway
zga00860  Porphyrin and chlorophyll metabolism
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ZOBELLIA_1310 (hemD)
Enzymes [BR:zga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ZOBELLIA_1310 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CAZ95366
UniProt: G0L3D2
Position
1563819..1564565
Genome map
AA seq 248 aa AA seqDB search
MKVKTILVSQPEPKMENSPYSKLIDKEKVKVDFRPFIHVEGVDAKDVRQQKIDLKNYTAI
ILTSRNAVDHFFRIAEEMRFKVPDSMKYFCQSEAVAYYLQKYVVYRKRKIYVGKRNFADL
VPLFKKYKGEKFLLPSSDALKPIIPEILDGLDIEWKRGIFYKTVISDLSDLRDVYYDILV
FFSPSGIESLLQNFPDFEQNDTRIAVFGNSTIDAATQAGLRIDIKAPTPETPSMTMALQK
YITTVNKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaaacgattttggtctcgcaaccagaaccgaagatggaaaactcaccgtat
tcgaaactgattgacaaggaaaaagtcaaagtagactttaggccttttattcatgttgag
ggtgtggatgctaaagatgtgcgccagcaaaaaatagatttgaaaaactatacggctatc
atcttgaccagccgcaacgccgttgaccatttcttccgcattgccgaagaaatgcgcttt
aaggtacccgactccatgaagtatttttgccagtcggaagccgtagcgtactatttacaa
aaatatgtagtataccggaagcgtaaaatctatgtcggcaagcgaaattttgccgatttg
gttcctttgttcaaaaagtacaaaggcgaaaaattccttttaccttcatctgatgccctc
aaacccatcattccagaaattttggacggattggacattgaatggaagcgtggtattttt
tacaagaccgtgataagcgacttatcggaccttcgcgatgtatactatgatatcttggta
ttctttagcccttcgggtattgaatccttgctacagaattttccggattttgagcaaaac
gatacgcgcattgccgtattcggcaactcgaccatagatgccgctacccaagccggccta
cgcatagacatcaaggctccaacgcctgaaacaccgtctatgaccatggcacttcaaaag
tacattactacggtaaacaagaaataa

DBGET integrated database retrieval system