KEGG   Zobellia galactanivorans: ZOBELLIA_1469Help
Entry
ZOBELLIA_1469     CDS       T01586                                 

Gene name
glpK
Definition
(GenBank) Glycerol kinase (EC:2.7.1.30)
  KO
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
zga  Zobellia galactanivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ZOBELLIA_1469 (glpK)
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ZOBELLIA_1469 (glpK)
Exosome [BR:zga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ZOBELLIA_1469 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1745868..1747349)
Genome map
AA seq 493 aa AA seqDB search
MKYIISLDQGTTSSRALLVDQEGKIQGMVQKEFKQIFPKSGWVEHDPKEILETQLGVLKE
LLKNEGVAASDILAIGITNQRETTMVWDKTTGEPVYNAIVWQDKRTADICEHLKKSGLSE
HVGQTTGLVIDSYFSGTKVKWILDNVEGARAKAENGDLLMGTVDTWLVWNMTNGANHVTD
YTNASRTMIYDIVNLKWDDKMLRALGIPKLMLPEVKPSAHHFGDYEIDGVKIPIAGIAGD
QQAALFGQACFNKGTAKNTYGTGCFMLMNTGEKPQFSKNGLLTTIAYGLDGKVNYALEGS
IFIAGAAIQWLRDGLEIIKDAKETEALADSVEGENPVYVVPAFAGLGAPYWDMYARGAVF
GLTRDTGKAHLAKATLESLAYQTKDILKAMEDDSGIQLKNLRVDGGACANNHLMQFQADI
LDSEVHRPEVIESTAMGAAFLAGIQVGLWKQEDVDQNRPMNRIFKPTFDRVKRKRLYKKW
KQAVERTKGWEEQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacattatatctctagaccaaggtaccaccagttctcgcgcattgcttgtagac
caagaaggcaagattcagggcatggtgcagaaagaattcaaacagatctttccaaagtcg
ggttgggtagaacacgaccccaaagaaattcttgaaacccaattaggggtgttaaaagaa
ttgttgaagaacgaaggtgttgccgcaagtgacattttggccattgggattaccaatcag
cgtgagaccacaatggtatgggacaaaactacgggcgagcccgtttataacgctattgtt
tggcaagataaacgtacggcagatatttgtgagcatttaaaaaagagtggattatcagag
cacgttgggcagactaccggacttgtaattgattcttatttttccggaaccaaggtaaag
tggattttagataatgtagaaggggcacgtgcaaaagccgaaaatggtgatttgttaatg
ggtactgtagatacttggttggtatggaatatgaccaatggtgcaaaccatgttacagat
tataccaatgcatcacgtaccatgatttacgatatcgtaaacctaaaatgggacgataag
atgctcagggcccttggcattccaaaattgatgcttcccgaagtaaaaccatcggcacat
catttcggtgattatgaaatcgatggggttaaaattccgattgccggtattgccggtgat
caacaggccgctttgttcggacaggcctgtttcaataaggggacggcaaaaaacacctat
ggaaccggttgttttatgttgatgaatacaggggaaaaacctcaattttccaaaaacgga
ctccttactaccattgcttacggattggatggaaaagtgaactatgcacttgaaggaagc
atatttattgcaggtgcagccatacagtggcttcgcgacggattggaaattattaaagat
gccaaggaaacagaagcgcttgccgattccgttgaaggtgaaaacccggtttatgtggtt
cccgcttttgcaggtttgggagcgccctattgggatatgtacgccaggggagcggtattt
ggattgaccagggatacgggtaaggcacatttggccaaggctactttagaatcattggct
taccagaccaaagatattttaaaagcgatggaagatgattctggaattcagttgaaaaac
cttcgtgtagatggtggtgcttgtgccaataaccatttaatgcaatttcaggccgatata
ttagattctgaggttcaccgcccagaggtaatagagtctacagctatgggtgccgcgttt
ttggcaggcattcaagtggggctgtggaaacaagaagatgtggatcaaaatagacctatg
aacagaatctttaagcctacctttgaccgcgtaaaacggaaacgtctttacaaaaaatgg
aagcaggccgtagagcgaaccaaaggatgggaagaacaataa

DBGET integrated database retrieval system