KEGG   Zobellia galactanivorans: zobellia_1855Help
Entry
zobellia_1855     CDS       T01586                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
zga  Zobellia galactanivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    zobellia_1855 (hemB)
Enzymes [BR:zga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     zobellia_1855 (hemB)
Exosome [BR:zga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   zobellia_1855 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2170125..2171114)
Genome map
AA seq 329 aa AA seqDB search
MYPLRRNRRLRTNDSIRHLVRETILSPKDFLVPLFVTEGKGIKEEIASMPDYYRLSLDLL
ETEIKELWNMGLHAVLLFVKVPDELKDNKGTEALNDDGLMQRAIKTIKNACPDMLVMTDV
AMDPYSSFGHDGIVENGLILNDETSEFLAEMSVSHALAGADFVAPSDMMDGRILSIREAL
EDEGLINTGIMSYSAKYASAFYGPFRDALDSAPVDVKNVPKNKKTYQMDYANRFEALKET
EMDVDEGADIVMVKPGLCYLDIVREIRNEVDVPVAVYQVSGEYAMVKAAAEKGWLDHDAV
VMEQLTAMKRAGANIIATYFAKDAIRLLD
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtacccacttagaagaaaccgtagattaagaacaaacgattccatcagacatttagta
cgcgaaaccattttatctcccaaggattttctggtaccgctttttgtgacggaaggcaag
ggcatcaaagaagagatcgcctctatgccggattattacagattgagcctcgaccttcta
gaaaccgagatcaaggaactatggaatatgggcttacatgccgttttgcttttcgtaaaa
gtaccggacgagctcaaggacaataaaggcaccgaggccctcaacgatgacggactcatg
caacgtgccataaaaaccataaaaaacgcatgtccggacatgttggtaatgaccgatgtc
gccatggacccctattcttcgttcggccatgatggtatagtcgagaacggattgatcctc
aatgatgaaacttcagaatttttggcagaaatgagcgtttcccatgccttggccggggca
gattttgttgcgccgagcgatatgatggacggccgtatcctttcgattcgtgaggcctta
gaagatgaaggccttatcaataccggaatcatgagctacagtgccaaatacgccagtgcc
ttctatggcccctttagagacgccttggattcggctcccgtggatgtcaagaacgtcccc
aagaacaaaaaaacctatcaaatggattatgccaatcggtttgaagccctaaaggaaacc
gaaatggatgtcgatgaaggagcggatatcgttatggtaaaacccggactctgctaccta
gatatcgtacgtgaaattcgcaatgaagtagatgtacccgttgccgtataccaagtaagc
ggcgagtatgccatggtaaaagcagccgcagaaaaaggatggctagaccacgatgccgta
gtaatggagcaactgaccgccatgaaaagagccggcgccaatatcattgcgacatatttt
gccaaagatgccattcgcttgttagattaa

DBGET integrated database retrieval system