KEGG   Zobellia galactanivorans: zobellia_1926Help
Entry
zobellia_1926     CDS       T01586                                 

Gene name
gmkA
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
zga  Zobellia galactanivorans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:zga00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2247215..2247799
Genome map
AA seq 194 aa AA seqDB search
MKGGKLIIFSAPSGSGKTTIVRHLLEQPELNLAFSVSATSRPRRAKEKQGEHYYFMSISE
FKNHIKNDDFLEWEEVYRDNFYGTLKSEIERLWAEGKNVIFDIDVAGGLRIKRKFPEETL
AVFVKPPSVDELKIRLKKRSTESEDKINMRIAKASVELATAPQFDKIIKNYDLDTALKEA
HELVADFVGAKIEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcggtaaattaattatattctcggcaccttcgggaagcggtaaaacaaccatt
gttagacatttgttagagcagcccgagctcaaccttgcattttcggtttcggccacctca
cggccgcgtagggccaaggaaaagcaaggggagcattattattttatgtcgatttcggag
tttaaaaaccatattaagaacgatgattttctcgaatgggaagaggtgtaccgcgataat
ttttacggtaccttaaaatctgagatcgagcgactctgggccgaaggcaaaaatgtcatt
tttgacatagatgttgcaggaggactacgtatcaaacgaaagtttccggaagagacccta
gccgtttttgtaaagccgccgagcgtagatgaacttaagatccgacttaaaaaacgcagt
accgaaagcgaggataaaatcaatatgcgaatagcgaaggcatcggtagagttggcgacc
gctccgcaattcgataaaattatcaagaattacgaccttgatacggccttaaaggaagcg
cacgagttggtggctgattttgtaggggcgaaaattgagaagtaa

DBGET integrated database retrieval system