KEGG   Zobellia galactanivorans: ZOBELLIA_1926Help
Entry
ZOBELLIA_1926     CDS       T01586                                 

Gene name
gmkA
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
zga  Zobellia galactanivorans
Pathway
zga00230  Purine metabolism
zga01100  Metabolic pathways
Module
zga_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ZOBELLIA_1926 (gmkA)
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ZOBELLIA_1926 (gmkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_22 CPT cobW AAA AAA_19 Viral_helicase1 Herpes_BLRF2 RsgA_GTPase AAA_30
Motif
Other DBs
NCBI-ProteinID: CAZ95979
UniProt: F6I9T8
Position
2247215..2247799
Genome map
AA seq 194 aa AA seqDB search
MKGGKLIIFSAPSGSGKTTIVRHLLEQPELNLAFSVSATSRPRRAKEKQGEHYYFMSISE
FKNHIKNDDFLEWEEVYRDNFYGTLKSEIERLWAEGKNVIFDIDVAGGLRIKRKFPEETL
AVFVKPPSVDELKIRLKKRSTESEDKINMRIAKASVELATAPQFDKIIKNYDLDTALKEA
HELVADFVGAKIEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcggtaaattaattatattctcggcaccttcgggaagcggtaaaacaaccatt
gttagacatttgttagagcagcccgagctcaaccttgcattttcggtttcggccacctca
cggccgcgtagggccaaggaaaagcaaggggagcattattattttatgtcgatttcggag
tttaaaaaccatattaagaacgatgattttctcgaatgggaagaggtgtaccgcgataat
ttttacggtaccttaaaatctgagatcgagcgactctgggccgaaggcaaaaatgtcatt
tttgacatagatgttgcaggaggactacgtatcaaacgaaagtttccggaagagacccta
gccgtttttgtaaagccgccgagcgtagatgaacttaagatccgacttaaaaaacgcagt
accgaaagcgaggataaaatcaatatgcgaatagcgaaggcatcggtagagttggcgacc
gctccgcaattcgataaaattatcaagaattacgaccttgatacggccttaaaggaagcg
cacgagttggtggctgattttgtaggggcgaaaattgagaagtaa

DBGET integrated database retrieval system