KEGG   Zobellia galactanivorans: zobellia_2015Help
Entry
zobellia_2015     CDS       T01586                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
zga  Zobellia galactanivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    zobellia_2015 (speB)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     zobellia_2015 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2352130..2353071
Genome map
AA seq 313 aa AA seqDB search
MSTTKNYAGIPDKFAQLETAKVVLIPVPYDGTSTWGKGADKGPQAFLEASENMELYDIET
DSEVYEQGIHLAEAITENSSPEAVVNAVHKQTKDYIKRNKFVTLFGGEHSISIGTIRAFN
ECFDNLTVLQIDAHADLRESYEGTKYNHACAVHEASQTTNLIQVGIRSMDAIEKSFMDEE
KTFFAHDMVHDEYWTDKVIEAMTDNVLITFDLDAFDPSIMPSTGTPEPGGLFWYETLEFL
KQVFKEKNVVGFDIVELCPNPADKSSDFLAAKLYYKMLSYKFMGEASDDEYDNTYDVDYK
SGTNGLKFDDDED
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaacaaagaattatgcgggcattcccgacaaattcgcacaattagaaacggcc
aaggtagttttaatacctgtgccttatgatggaacaagtacttggggcaaaggtgccgat
aagggcccccaagcatttttagaggcttccgagaatatggagctttacgatatcgaaacc
gatagcgaggtgtatgagcaaggcattcatttggccgaggccataaccgagaacagctca
ccggaagccgtggtaaacgctgttcataaacagaccaaagattacattaagcgcaacaag
ttcgtaaccttgttcgggggggagcattccatttcgataggtacgatccgcgcctttaac
gaatgtttcgataatctgaccgttttgcagatcgatgcccatgccgacctacgcgagtcg
tacgagggtacaaaatacaaccatgcctgtgcggttcacgaagccagtcagaccacaaat
ctgatccaagtagggattcgttccatggatgctatagaaaaatcgtttatggacgaagaa
aagaccttctttgcccacgatatggtacatgatgagtattggacggacaaggtaatcgaa
gccatgaccgacaacgtcttgattacctttgatcttgatgcctttgatccttcgatcatg
ccttcaacgggaactcccgagccagggggactcttttggtacgagaccttagagttttta
aaacaggtattcaaggagaaaaacgtagtgggctttgatattgtggagctctgtcccaat
cccgcggataaatcttcagattttcttgccgctaaattgtattataaaatgctaagctat
aaatttatgggtgaggcgtcagatgacgaatatgacaatacctacgatgtagattacaaa
tcaggtacgaacggtttaaaatttgatgatgacgaagactaa

DBGET integrated database retrieval system