KEGG   Zobellia galactanivorans: zobellia_208Help
Entry
zobellia_208      CDS       T01586                                 

Gene name
engA
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
zga  Zobellia galactanivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    zobellia_208 (engA)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     zobellia_208 (engA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(249036..250229)
Genome map
AA seq 397 aa AA seqDB search
MRKTVLIFMVLSVNFSLFTSCGEKEHSDGAHVSGDPDIREMSKEEGNEEDGEDDGNMREI
APKEFVLDMGAGWNLGNAMDTYNSDETAWGNPLTTKAMIDEIAKMGFKTLRLPVTWKFHI
GEGPDYLIEANWLDKVEAIANFALENEMYVIINIHHDETWILPTYEKADEVKDELSKVWT
QIANRFKTYGDYLIFETLNEPRHKGTPEEWKGGTQEGRDAVNQYHQVSVDAIRATGGNNA
KRKIMVSTYAASTASNALNDYLVPNGDKNVIVSVHSYFPYQFCLDGTDSTWGTEADKTAL
LAELDKIRDKFIVEDNRAVVMGEWGSTFSDNPEDRLAHAEFYARACAERGICPIWWDNGN
VDEFGIFNRNTLEWNYPEIAEAIVKETTEARSKAKTE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaacagttctaatttttatggtgcttagtgtaaacttcagtctttttacgtct
tgtggcgaaaaggagcattcagatggggctcatgtctcgggtgatcctgacatacgcgaa
atgtcaaaagaagaagggaatgaagaagatggggaggatgacggcaatatgagggagata
gcccctaaggaattcgttcttgacatgggggccggttggaacttgggcaatgcaatggat
acctataacagtgacgagacggcttggggaaaccccttgaccactaaggccatgatcgat
gaaattgccaaaatgggatttaaaaccttacgtttaccggttacttggaagtttcatata
ggggagggcccagactatcttattgaagcaaattggttggataaggtcgaggccattgcc
aattttgccctcgaaaatgagatgtatgtgatcataaatatacaccatgatgaaacatgg
atccttcctacctatgaaaaggccgatgaagtaaaagatgaactttcgaaggtatggacg
caaatagccaataggttcaagacttacggcgattaccttatttttgaaaccctaaatgaa
ccgagacataagggtacgcccgaggaatggaaaggaggtacacaagaaggccgtgatgcc
gtcaatcaatatcaccaggtcagtgtcgatgccattcgggccacggggggcaataatgca
aagcgaaaaataatggtgtctacctatgctgcaagtaccgcttcaaatgctttgaacgac
tatcttgtacccaatggggataaaaatgttattgtatcggtgcatagctatttcccttat
cagttttgtttggatggaacggactccacttggggaaccgaagccgacaaaaccgcctta
cttgcggagttggataaaatccgtgataaattcatcgtcgaagataatagggccgtggtc
atgggggagtggggctcaaccttcagtgataatcccgaagaccgcttggcccatgccgaa
ttctatgccagggcctgcgccgaaaggggcatttgtcccatttggtgggataacgggaat
gttgatgagttcggtatttttaatagaaatacccttgagtggaattaccctgaaattgcc
gaggccattgttaaggaaacgactgaggcccgttcaaaggcaaaaacggaatag

DBGET integrated database retrieval system