KEGG   Zobellia galactanivorans: zobellia_2089Help
Entry
zobellia_2089     CDS       T01586                                 

Definition
(trans)glycosidase superfamily protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
zga  Zobellia galactanivorans
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    zobellia_2089
  Lipid metabolism
   00561 Glycerolipid metabolism
    zobellia_2089
   00600 Sphingolipid metabolism
    zobellia_2089
Enzymes [BR:zga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     zobellia_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2436080..2437852
Genome map
AA seq 590 aa AA seqDB search
MIANTTITSFPEIIIIGEKQNFRTTLNKVYGDEGVTLYDFEVNNDVEEVPKPITLQWKVP
AINVKGVWKPTTDFNKRIQADWELDNMESRISIDSPVISLFGNSDGNVLTFACSNAINKL
EMNARLREEDNCFYCHVTFFTEQHYPLKNFKVQLRLDYQDWHFSDSLRAVASWWESFEQL
KPAYVPDIAKTPLYSTWYQFHQNLDVPLLLKECRLAKNLGYKAIIIDDGWQTFDSNRGYD
FTGDWQPDRIPEMAEFVKSVHETGMKIALWYSVPFCGEKSKAYKRFKGKFLTEDHRWAPV
FDPRYPDVRQYLIDIYTNAARDWSLDGFKLDFIDDFRFYKDTPTKLGPDADYASINGAVD
RLLTDVKDALTKINPEIFIEFRQKYTGPAMRKYGNMFRAFDCPGDATMNRLRIADIRMLA
GNTAVHSDMVTWHADEPLEIAALQVINTLFGVPQLSVMLSETPEAYVNMIGFYTKYWNEN
ADVLMNGYFLPSKPLANYPTQRVSKNGHLIIGVYDAWVVELDGAYTHIDILNAQIATQVV
VRILNDLGAYACKVYDCQGNLIREENVVFSKGVIEVEVPECGIIRAEKIE
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgattgcaaacactaccattacaagctttccggaaataatcattatcggggaaaaacaa
aatttccgtaccaccctgaataaggtatatggggatgaaggggtaacgttatacgatttt
gaagtcaacaatgatgtcgaagaggtgcccaaacctataaccttgcaatggaaggttccg
gccatcaacgtaaagggcgtttggaaacccaccacggatttcaataaacgtattcaagcc
gattgggaacttgacaatatggagtcgcggatttctatcgattcgcccgtaatttcccta
tttgggaatagcgatggcaatgtcttgaccttcgcttgctccaatgccatcaataaattg
gaaatgaatgcccgtttacgtgaagaggacaattgtttttattgccacgttacctttttt
acggaacaacattatccccttaaaaattttaaggtgcaattgcgattggattatcaagac
tggcatttttccgatagccttcgggcggtggcttcgtggtgggaaagctttgagcaattg
aagccggcctatgtacctgatatcgctaaaacgccattgtactctacctggtaccagttt
catcagaacctcgatgtacccttgcttttgaaagaatgtcgattggcaaaaaatctgggc
tacaaagctatcatcattgatgacggttggcaaaccttcgattcgaaccgaggctatgat
tttacgggggattggcagccagaccgtattcctgaaatggcggaattcgtaaaaagtgta
catgaaaccggtatgaaaatcgctctttggtactccgttcccttctgtggtgaaaaatca
aaggcctacaaacgttttaaagggaaattcctgaccgaagaccatagatgggctcctgtt
tttgatccacgttatcccgatgttaggcaataccttatcgatatttataccaatgccgcg
cgagattggagcctcgacggcttcaagcttgattttatcgacgactttaggttttataaa
gataccccgactaaattggggccagatgcggattatgcgtcgataaatggggctgttgat
cgcttgttgacagatgtgaaagacgccttgacaaaaattaaccccgaaatctttattgag
ttcagacagaagtatacgggacctgcgatgcgtaaatacggtaatatgttcagggccttc
gactgtccgggagatgctaccatgaaccgattgcgaattgcggatattcgtatgcttgcc
ggaaatactgcggtacactccgatatggttacctggcatgcggacgaacccttggaaatt
gcggctcttcaagtcatcaatacgctttttggggtgccccaactttccgttatgttgagt
gagacacccgaagcatacgtaaacatgatcggcttttatacgaagtactggaacgaaaat
gccgatgtgcttatgaacggatatttccttccttctaaaccgttggccaattaccccacc
caacgggtatctaagaacggacacctcattattggggtttatgatgcttgggtagtagag
ctcgatggggcttatacgcacatagatatcttgaatgctcaaatagccacccaagtagtc
gttcgaattttaaatgatttgggggcttatgcctgtaaagtctatgattgtcaaggaaat
ttgataagggaggagaatgtagtattttcgaaaggggtaatagaggtggaggttcccgaa
tgcggaatcataagggccgagaaaatagagtag

DBGET integrated database retrieval system