KEGG   Zobellia galactanivorans: zobellia_2236Help
Entry
zobellia_2236     CDS       T01586                                 

Gene name
nosZ
Definition
nitrous oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
zga  Zobellia galactanivorans
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    zobellia_2236 (nosZ)
Enzymes [BR:zga01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     zobellia_2236 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2624197..2626158
Genome map
AA seq 653 aa AA seqDB search
MKKYTFHLFAILGMALFLSSCGDQNGKASSNSGLSSNNAEKVYVAPGEHDEFYAFMSGGY
SGNLTVYGLPSGRMFKEIPVFSQFPTSGYGYSEETKPMLNTSFGFVPWDDAHHPDISQTN
GELDGRWIFINGNNTPRIARISLSTFETEEIMEVPNSAGNHSSSFVTENTEYVVAGTRFS
VPIPQRDMPINEYKGNFRGSLSFISVDPEDGHMDLKFQILMPGFNYDLSHPGRGKSHGWF
FFTTYNTEEANSLLEVNASQNDKDFIAAVNWKKIEEYVANGGGTMMPAEYAHNVYDEASH
TATSTLKKEVLTIDPTKVPGAVYFLPTPKSPHGVDVDPSGEYIIGNGKLSADLTIHSFDK
MVAAIEAKKFDGEAYGIPILKFDDVLAGTVKSGGLGPLHTEFDGEGNAYTTFFISSEVVM
WKLGTWEVIDRKPTYYSVGHLMIPGGNSRKPFGKYVVAMNKITKDRYLPTGPELEHSAQI
YDISGDKMELIYDFPTHGEPHYAAGIPAELLAPKSKKIYKLSENKHPFAATGPADTKVVR
EGNEVHIYMSMIRSHFTPDNIEGIKVGDKVYFHVTNQEQDFDVPHGFAMIGANNSELLIM
PGQTKSLVWEPKKVGVWPFYCTDFCSALHQEMQGYIRVSPAGSNTELSWSLGE
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatacctttcatctattcgcgattttagggatggctctgttcctctctagt
tgcggtgaccagaacggcaaggcgtcctcaaatagcggactatcgtcgaacaatgcggaa
aaagtatacgttgccccgggagagcatgatgagttttatgcttttatgtcgggcgggtat
agcggaaaccttacggtttacggacttccttcgggaagaatgttcaaagagattcccgtt
ttttcgcagtttcctacctcgggttatggatattcggaagaaacaaaacccatgttgaac
acatctttcggtttcgttccttgggatgatgcccaccaccccgatatttcccagaccaat
ggggagttagacggtagatggatatttattaatggaaacaacacaccaagaattgcccgg
atcagcttgagtacgttcgagaccgaggaaattatggaggtacccaacagtgcagggaac
cacagttcttcttttgttaccgaaaataccgagtatgtagttgccggaacccgtttttcg
gtgcctattccccaaagggatatgcccattaacgagtacaaggggaattttaggggctcg
ctttcctttataagcgttgatcctgaagatggacacatggatctaaagtttcaaattttg
atgccagggtttaattacgacctgtcgcatccgggtaggggcaaatcccatggatggttt
ttctttacgacctacaataccgaagaggcaaattcacttttagaagtaaatgcttcgcaa
aacgataaagattttatcgctgcggtgaattggaagaaaattgaagagtatgtggcaaat
ggagggggtacaatgatgccggccgaatatgcccacaatgtgtacgatgaagcaagccat
accgcgacttccaccctaaaaaaggaagtcttgaccatagacccgaccaaagtgccggga
gccgtttacttcttgcctacaccaaaatcgccccatggggtagatgttgatccttcggga
gagtatatcattggtaacggaaagctatcggccgatcttacgatccattccttcgataaa
atggtggctgcgatcgaagctaaaaaattcgacggagaagcttatggcatccccatcttg
aaattcgacgatgtacttgccggaaccgtgaaaagtggcggattgggccccttacatacc
gagtttgatggagagggaaatgcctatactaccttctttatttcctctgaagtggtgatg
tggaagttgggtacatgggaagttatcgatagaaaacctacttattattccgtgggacac
ttaatgatacctggggggaactctaggaagccctttggtaaatacgtggtggccatgaac
aaaataaccaaagataggtacctgcccacaggtcccgaactggaacattccgcccagatt
tatgatatttccggagataaaatggagcttatttacgattttcccacccacggtgaaccc
cattatgcagcaggtatacccgctgaacttttggccccgaaatctaagaagatctataag
ctttccgaaaataaacacccctttgccgcaaccggccccgccgatactaaagtggtaagg
gaagggaatgaggttcatatttacatgtctatgatccgaagccactttacccctgataat
atagaaggtattaaagtgggcgacaaggtgtattttcatgtcaccaaccaagaacaagat
tttgatgtgccccatgggtttgccatgatcggcgcgaataactccgaattgctaattatg
ccagggcagaccaaatctctggtatgggagcctaaaaaagtaggggtatggccattttat
tgtaccgatttctgttccgctttgcaccaagaaatgcaaggttatatacgggtgtcaccg
gcaggttcaaatactgagctgtcgtggtccctaggagaataa

DBGET integrated database retrieval system