KEGG   Zobellia galactanivorans: zobellia_2376Help
Entry
zobellia_2376     CDS       T01586                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
zga  Zobellia galactanivorans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:zga03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2790850..2791431
Genome map
AA seq 193 aa AA seqDB search
MITHLRGKLVEKNPTYVVIECAGVGYFVNISLNTFAKVGDSESISLFTHLQVKEDSHTLF
GFAERSEREIFRLLLSVSGIGSSTARTMLSSLEPAQIRDAIANGDVATIQSIKGIGAKTA
QRVILDLRDKILKVYDIGEVSAAANNTNKEEALSALEVLGFVRRSAEKVVDKVLAQDPSL
SVENIIKLALKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgcatcttagaggaaaacttgtagagaagaacccgacctatgtcgtaattgaa
tgtgcaggggtgggttattttgtcaatatttcgctcaatacctttgccaaggtgggcgac
tctgagagtataagtttgttcacccatctacaggtgaaagaagattctcacaccttgttc
gggtttgccgaaagatcggaacgcgaaattttccggcttttgctttcggtttccggtatt
ggatcaagtaccgcacggaccatgttatcgtcgttggagcccgctcagattagggatgcc
attgccaatggtgacgtggccacgattcaatcgataaaaggtatcggggccaaaacggcc
caacgcgtaattctcgacctacgcgataagattctaaaagtgtacgatataggtgaagtt
tccgctgctgcgaacaatacaaataaagaagaagcgttatctgctttagaggttcttggc
tttgtaagaagatccgccgaaaaggtagttgataaagtacttgcccaagacccctcgctc
agcgtagagaatattattaaacttgcgcttaaaaatttataa

DBGET integrated database retrieval system