KEGG   Zobellia galactanivorans: ZOBELLIA_2376Help
Entry
ZOBELLIA_2376     CDS       T01586                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase (EC:3.6.1.-)
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
zga  Zobellia galactanivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ZOBELLIA_2376 (ruvA)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ZOBELLIA_2376 (ruvA)
DNA repair and recombination proteins [BR:zga03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ZOBELLIA_2376 (ruvA)
    RecFOR pathway proteins
     ZOBELLIA_2376 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2790850..2791431
Genome map
AA seq 193 aa AA seqDB search
MITHLRGKLVEKNPTYVVIECAGVGYFVNISLNTFAKVGDSESISLFTHLQVKEDSHTLF
GFAERSEREIFRLLLSVSGIGSSTARTMLSSLEPAQIRDAIANGDVATIQSIKGIGAKTA
QRVILDLRDKILKVYDIGEVSAAANNTNKEEALSALEVLGFVRRSAEKVVDKVLAQDPSL
SVENIIKLALKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgcatcttagaggaaaacttgtagagaagaacccgacctatgtcgtaattgaa
tgtgcaggggtgggttattttgtcaatatttcgctcaatacctttgccaaggtgggcgac
tctgagagtataagtttgttcacccatctacaggtgaaagaagattctcacaccttgttc
gggtttgccgaaagatcggaacgcgaaattttccggcttttgctttcggtttccggtatt
ggatcaagtaccgcacggaccatgttatcgtcgttggagcccgctcagattagggatgcc
attgccaatggtgacgtggccacgattcaatcgataaaaggtatcggggccaaaacggcc
caacgcgtaattctcgacctacgcgataagattctaaaagtgtacgatataggtgaagtt
tccgctgctgcgaacaatacaaataaagaagaagcgttatctgctttagaggttcttggc
tttgtaagaagatccgccgaaaaggtagttgataaagtacttgcccaagacccctcgctc
agcgtagagaatattattaaacttgcgcttaaaaatttataa

DBGET integrated database retrieval system