KEGG   Zobellia galactanivorans: zobellia_2419Help
Entry
zobellia_2419     CDS       T01586                                 

Gene name
proB1
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
zga  Zobellia galactanivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:zga01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:zga00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2863599..2864384)
Genome map
AA seq 261 aa AA seqDB search
MHKELIVIKVGTNVMTNKDNRIVRPVLRRLVEQIAELYERGIITILVSSGSVIAGKEVLG
NSSIENDTQRRQVYSAIGQPRMMRLYYNIFHDYGMKCAQVLPTKRDFSPGVHRQNMIKCC
EGLLAEGVIPIANEDDAVSVTMSMFSDNDELASLIAQLMNADKLIILTDIDGLYTGHPNA
EDSDLIPHVGPEDNFEAYIKDSNKAAGEGRGGMGSKLDYAQQAAAKSIPTYIANGKKDRT
IIDIIDGKNVGTRVALEKQEV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcataaggaactcatcgttataaaggtcggcaccaacgtaatgaccaataaagacaat
cgtatcgtacgccccgtactccgccggttggtagaacagattgccgagctctatgagcgt
ggcatcatcaccattttggtctcttcaggttcggtaatcgcgggcaaggaagtattgggc
aattcaagtattgaaaacgatacccagagaagacaggtatattcggccatcggtcaaccc
cgaatgatgcgcctttactataatatttttcatgattacggtatgaaatgtgcccaagta
ctgcccaccaaacgcgattttagtccgggcgtacaccgccagaacatgatcaagtgttgt
gaaggcctgttagccgaaggggtcattcccatagccaatgaagacgatgcggtatccgtt
accatgtctatgttttcagataacgacgagttggccagtttgatcgcacaattgatgaat
gcggataagttgatcatcctcaccgatattgacggactttacactggccatccgaatgcc
gaagacagtgaccttattccacatgtaggaccggaagacaattttgaagcctatatcaaa
gacagtaacaaggctgccggtgaaggcaggggcggtatgggctcaaaactagactatgcc
cagcaggccgccgccaaaagcatacccacctatatcgccaacggaaaaaaagaccgtacg
ataatcgatattatagacggaaaaaacgtggggacccgagtggccctcgaaaaacaggaa
gtataa

DBGET integrated database retrieval system