KEGG   Zobellia galactanivorans: ZOBELLIA_2419Help
Entry
ZOBELLIA_2419     CDS       T01586                                 

Gene name
proB1
Definition
(GenBank) Glutamate 5-kinase (EC:2.7.2.11)
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
zga  Zobellia galactanivorans
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZOBELLIA_2419 (proB1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ZOBELLIA_2419 (proB1)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ZOBELLIA_2419 (proB1)
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ZOBELLIA_2419 (proB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2863599..2864384)
Genome map
AA seq 261 aa AA seqDB search
MHKELIVIKVGTNVMTNKDNRIVRPVLRRLVEQIAELYERGIITILVSSGSVIAGKEVLG
NSSIENDTQRRQVYSAIGQPRMMRLYYNIFHDYGMKCAQVLPTKRDFSPGVHRQNMIKCC
EGLLAEGVIPIANEDDAVSVTMSMFSDNDELASLIAQLMNADKLIILTDIDGLYTGHPNA
EDSDLIPHVGPEDNFEAYIKDSNKAAGEGRGGMGSKLDYAQQAAAKSIPTYIANGKKDRT
IIDIIDGKNVGTRVALEKQEV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcataaggaactcatcgttataaaggtcggcaccaacgtaatgaccaataaagacaat
cgtatcgtacgccccgtactccgccggttggtagaacagattgccgagctctatgagcgt
ggcatcatcaccattttggtctcttcaggttcggtaatcgcgggcaaggaagtattgggc
aattcaagtattgaaaacgatacccagagaagacaggtatattcggccatcggtcaaccc
cgaatgatgcgcctttactataatatttttcatgattacggtatgaaatgtgcccaagta
ctgcccaccaaacgcgattttagtccgggcgtacaccgccagaacatgatcaagtgttgt
gaaggcctgttagccgaaggggtcattcccatagccaatgaagacgatgcggtatccgtt
accatgtctatgttttcagataacgacgagttggccagtttgatcgcacaattgatgaat
gcggataagttgatcatcctcaccgatattgacggactttacactggccatccgaatgcc
gaagacagtgaccttattccacatgtaggaccggaagacaattttgaagcctatatcaaa
gacagtaacaaggctgccggtgaaggcaggggcggtatgggctcaaaactagactatgcc
cagcaggccgccgccaaaagcatacccacctatatcgccaacggaaaaaaagaccgtacg
ataatcgatattatagacggaaaaaacgtggggacccgagtggccctcgaaaaacaggaa
gtataa

DBGET integrated database retrieval system