KEGG   Zobellia galactanivorans: zobellia_2595Help
Entry
zobellia_2595     CDS       T01586                                 

Gene name
ccpA2
Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
zga  Zobellia galactanivorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3049888..3051060
Genome map
AA seq 390 aa AA seqDB search
MVKIGVRLIVVLLLVSCRDTNGKPKKTSKSNRVVTTYIALPKKVKSPKDNPASPEKEALG
KLLFYDPVLSGNKDVACATCHHPQNGYAEFLDISIGPNATGLGARRKFNAPNDIPFVKRN
APTIINSAYNGIDPFGNYDPEQATMFWDDRVKSLEKQALEPIKAFEEMRGHGIGVDSILQ
VVVDRVKQIPEYQQMFADAFGVPNAVTVENLGKAIAAFERSLVTNNSRFDQFMRGDEDAI
LISEKEGFELFKSVGCVNCHNGPMFSDYKMHVLGTPENDKLGEPDRGVKDTFAFRTPTLR
NLRFTAPYMHNGSLPTLKKVLEFYEDIANGKERNPHVPVQKYDPFVRDLNLSVKEMSQII
SFLNTLNDDGFDKTVPERVPSGLPVGGNIQ
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaataggggtgcgtttaatagtagtcttgttattggtgagctgtagggacacc
aatgggaagcccaaaaaaacgtcaaaatcgaaccgggtcgtaacaacttatattgcattg
cccaaaaaggtgaaatcacctaaggacaacccggcttcccctgaaaaggaggccttgggg
aaattacttttttacgaccccgttctttccggaaacaaggatgtggcctgtgccacctgc
catcacccccaaaacggttatgcagagtttttggatatcagtattggtcccaatgctact
ggcctgggtgcccgtaggaaattcaatgcgcccaacgatattccctttgtaaaaagaaat
gccccaaccattatcaattcggcctacaatggaatagaccccttcggcaactatgatccg
gaacaagccactatgttttgggacgatcgtgttaagagtcttgaaaaacaggccttggag
ccgataaaggcctttgaggaaatgcgtgggcacggtataggtgtcgatagcatattgcag
gttgtggtggatcgcgtaaagcaaattcccgaatatcaacaaatgttcgccgatgccttt
ggtgtgccgaatgcggtaacggtagaaaatttaggaaaggccatcgccgcctttgagcgt
tcgttggtaacgaacaattcgcgcttcgatcaatttatgaggggagatgaggatgcaatt
ctaatttcggaaaaagaaggttttgaactgtttaagtcggtaggttgcgtcaattgccac
aatggtcccatgttttctgattataagatgcacgtattgggtacccctgaaaacgataag
ctgggcgaacccgatagaggagtgaaggatacctttgcctttcgtacgcctactttacgg
aatctacgctttaccgccccttatatgcataatgggagtttgcctaccctcaaaaaggtg
ctggaattttatgaggatatcgccaatggtaaggagcgtaacccacatgtaccggtacaa
aagtacgatccttttgtgcgcgatctcaacttgtcggtcaaggagatgtcccaaatcatt
tcatttttaaacacgcttaacgacgatggttttgacaagaccgtacccgagcgcgtaccc
agtggcttgccggtagggggcaatattcaataa

DBGET integrated database retrieval system