KEGG   Zobellia galactanivorans: ZOBELLIA_2675Help
Entry
ZOBELLIA_2675     CDS       T01586                                 

Definition
(GenBank) Sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
zga  Zobellia galactanivorans
Pathway
zga00010  Glycolysis / Gluconeogenesis
zga00052  Galactose metabolism
zga00500  Starch and sucrose metabolism
zga00520  Amino sugar and nucleotide sugar metabolism
zga00521  Streptomycin biosynthesis
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01120  Microbial metabolism in diverse environments
zga01130  Biosynthesis of antibiotics
zga01200  Carbon metabolism
Module
zga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZOBELLIA_2675
   00052 Galactose metabolism
    ZOBELLIA_2675
   00500 Starch and sucrose metabolism
    ZOBELLIA_2675
   00520 Amino sugar and nucleotide sugar metabolism
    ZOBELLIA_2675
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ZOBELLIA_2675
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ZOBELLIA_2675
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ZOBELLIA_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: CAZ96825
UniProt: G0LCC4
Position
3134541..3135503
Genome map
AA seq 320 aa AA seqDB search
MLKETVVLAADVGGSHITLALVVKGHVMDSVTIKAEPIKGMRAYLPLMEQMAKQLVENNS
LSFLDLAGFGMALPMLVDSKKNTVLSCANNKYEDAVEIDFEQWAREKFGLQIRLEVDGNL
GCMGEWNYGAGKGVQDLVYVILGTGYGSSVVLGGQPLRGRNFTAGILAGHMVVNPMGSKC
ICPGNGCVESETGTWALPGIARKTEGFHTSLLAKREKIDYAALFEDHALNDSVATKILER
SIMYWGASLVNLIYAYNPQKIIMAGSVIKAGDYIIPRLDAYIKKQLWTIGEYPEICKAQH
FDTAALLGCYSLVTTSDEYE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagaaacggtagtcttagcggccgacgttggggggtctcatattaccttggcg
cttgtcgtaaaaggtcatgtcatggattctgtaactattaaggctgagcctataaagggg
atgagggcctatctgcctttgatggaacaaatggcgaaacagctcgtggagaacaattcg
ttgagctttcttgatcttgccggttttggtatggcgctcccgatgttggttgattcaaaa
aagaatacggtactgtcttgtgccaataataaatatgaagatgctgtcgaaattgatttt
gaacaatgggcgagggaaaaattcggcttgcaaattagactggaagttgatggaaacctt
ggctgtatgggagagtggaactatggtgccggaaagggagtgcaagacttggtctatgtg
attttaggaactggttacggaagttcggtcgtgctcggtggccaaccgctaagggggcga
aattttaccgctggaattttagcgggtcatatggtggtcaaccctatgggaagcaaatgc
atttgcccgggaaatggttgtgtcgaaagcgaaaccggtacatgggcactgccaggaatc
gctagaaaaaccgagggattccataccagtctattggcgaaaagggaaaaaatagattat
gcggcattgtttgaagaccacgccttaaacgatagtgtcgccactaaaattttagagcgg
agcatcatgtattggggggcctctttggtaaaccttatctacgcctacaatccccaaaaa
attatcatggccggttcggtcataaaggcaggtgattacatcattccgagattggacgcc
tatattaaaaaacaattatggacgattggggagtatcctgaaatatgcaaggcccaacat
tttgatacggcagcattgttagggtgttattccttggtcactacctctgatgaatatgaa
tga

DBGET integrated database retrieval system