KEGG   Zobellia galactanivorans: zobellia_2675Help
Entry
zobellia_2675     CDS       T01586                                 

Definition
sugar kinase (EC:2.7.1.-)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
zga  Zobellia galactanivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    zobellia_2675
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    zobellia_2675
   00052 Galactose metabolism
    zobellia_2675
   00500 Starch and sucrose metabolism
    zobellia_2675
   00520 Amino sugar and nucleotide sugar metabolism
    zobellia_2675
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    zobellia_2675
   00524 Butirosin and neomycin biosynthesis
    zobellia_2675
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     zobellia_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3134541..3135503
Genome map
AA seq 320 aa AA seqDB search
MLKETVVLAADVGGSHITLALVVKGHVMDSVTIKAEPIKGMRAYLPLMEQMAKQLVENNS
LSFLDLAGFGMALPMLVDSKKNTVLSCANNKYEDAVEIDFEQWAREKFGLQIRLEVDGNL
GCMGEWNYGAGKGVQDLVYVILGTGYGSSVVLGGQPLRGRNFTAGILAGHMVVNPMGSKC
ICPGNGCVESETGTWALPGIARKTEGFHTSLLAKREKIDYAALFEDHALNDSVATKILER
SIMYWGASLVNLIYAYNPQKIIMAGSVIKAGDYIIPRLDAYIKKQLWTIGEYPEICKAQH
FDTAALLGCYSLVTTSDEYE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagaaacggtagtcttagcggccgacgttggggggtctcatattaccttggcg
cttgtcgtaaaaggtcatgtcatggattctgtaactattaaggctgagcctataaagggg
atgagggcctatctgcctttgatggaacaaatggcgaaacagctcgtggagaacaattcg
ttgagctttcttgatcttgccggttttggtatggcgctcccgatgttggttgattcaaaa
aagaatacggtactgtcttgtgccaataataaatatgaagatgctgtcgaaattgatttt
gaacaatgggcgagggaaaaattcggcttgcaaattagactggaagttgatggaaacctt
ggctgtatgggagagtggaactatggtgccggaaagggagtgcaagacttggtctatgtg
attttaggaactggttacggaagttcggtcgtgctcggtggccaaccgctaagggggcga
aattttaccgctggaattttagcgggtcatatggtggtcaaccctatgggaagcaaatgc
atttgcccgggaaatggttgtgtcgaaagcgaaaccggtacatgggcactgccaggaatc
gctagaaaaaccgagggattccataccagtctattggcgaaaagggaaaaaatagattat
gcggcattgtttgaagaccacgccttaaacgatagtgtcgccactaaaattttagagcgg
agcatcatgtattggggggcctctttggtaaaccttatctacgcctacaatccccaaaaa
attatcatggccggttcggtcataaaggcaggtgattacatcattccgagattggacgcc
tatattaaaaaacaattatggacgattggggagtatcctgaaatatgcaaggcccaacat
tttgatacggcagcattgttagggtgttattccttggtcactacctctgatgaatatgaa
tga

DBGET integrated database retrieval system