KEGG   Zobellia galactanivorans: ZOBELLIA_2729Help
Entry
ZOBELLIA_2729     CDS       T01586                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
zga  Zobellia galactanivorans
Pathway
zga00010  Glycolysis / Gluconeogenesis
zga00520  Amino sugar and nucleotide sugar metabolism
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01120  Microbial metabolism in diverse environments
zga01130  Biosynthesis of antibiotics
zga01200  Carbon metabolism
Module
zga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZOBELLIA_2729 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    ZOBELLIA_2729 (ppgK)
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     ZOBELLIA_2729 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: CAZ96879
UniProt: G0L6E5
Position
complement(3190806..3191555)
Genome map
AA seq 249 aa AA seqDB search
MEVLGIDVGGSGIKGALVNIETGKLVSERHRIPTPVGRKPEDMANVIAQIVAHFDYKGKV
GCGFPTVIKKGICKSPGNLHKSWLNVNVEKLFEEKTGLDFTVVNDADIAGYACMNYGIGK
GMQGLVIMITIGTGLGSGAFLDGRLIPNFELGQIPYKKYKKIELWAAGSAKDREGLSYKK
WGKRFNKFLKYVELLVAPDTILIGGGASKDFDQFKECITIETPVIPAELQNHAGIIGAAA
AAFHTVPKH
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggaagttcttggtatagatgtaggtggttcgggcataaaaggtgccttagtgaacata
gaaaccggcaaattggtttctgaacgccatcgtatacctacgcctgtcggacgcaagccc
gaagacatggccaacgttatcgctcaaatcgtagcccatttcgattacaaaggaaaagta
ggttgcggttttccgaccgtaatcaaaaaaggaatctgtaaatcccctggaaaccttcat
aaaagttggttgaacgtcaatgttgaaaaactcttcgaagaaaaaaccggattggatttt
accgtagtaaacgatgccgatattgcaggctatgcctgtatgaactacggtataggaaaa
ggcatgcaaggcttggtcattatgatcaccattggtaccggccttggtagcggtgctttt
ttagacggcaggttgatccctaattttgaactaggacaaattccttataaaaaatacaaa
aaaatagagctttgggccgcaggatccgccaaagaccgagaaggactatcctataaaaaa
tggggaaagcgtttcaacaagttcttaaaatatgttgaattgctggtagctcccgacacc
attcttatcggtgggggcgcatctaaagattttgaccagttcaaggagtgcataaccata
gaaactccggtcattcctgcggagctacagaaccatgccggtattataggtgcggctgcc
gcagcctttcatacggtgcccaaacactaa

DBGET integrated database retrieval system