KEGG   Zobellia galactanivorans: zobellia_2743Help
Entry
zobellia_2743     CDS       T01586                                 

Gene name
asnB1
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
zga  Zobellia galactanivorans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:zga00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3208752..3210416
Genome map
AA seq 554 aa AA seqDB search
MCGIVCAFDLKESSDVLRPQLLEMSKKIRHRGPDWSGIYADEKAILAHERLAIVDPASGK
QPLFSEDNKLVLAANGEIYNHRELRKQFDGKYNFQTESDCEVILALYQEKGADFLDEMNG
IFGFAIYDTENDSYFVARDHMGIIPLYIGWDQNGTFYVASELKALEGTCTKIELFPPGHY
LSSEDGEFKRWYSRDWMEYDAVKENETSIQEIKEALEAAVHRQLMSDVPYGVLLSGGLDS
SVTSAIAKKYAQKRIESGDTTDAWWPQLHSFSVGLEGSPDLAAAQKVADHIGTVHHEIKF
TIQEGLDAIKDVVYNLETYDITTIRASTPMYLMARVIKSMGIKMVLSGEGADELFGGYLY
FHKAPNDKEFHEETVRKLSKLHMYDCLRANKSLAAWGIEGRVPFLDKEFIDVAMRINPKD
KMINGERMEKWVVRKAFEDMLPESVAWRQKEQFSDGVGYSWIDTLKEIVNEEVTDEQLAN
AKFRFPVQTPTSKEEFYYRSIFESHFPSDAAALCVPQEASVACSTQIALEWDEAFKNMND
PSGRAVANVHDDAY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtatgtgcatttgatttaaaggaaagttcagatgttttaaggccccag
ttgttggagatgtctaagaaaattcgtcaccgtggcccggactggagtggtatttacgca
gatgagaaggccatattggcccatgagcgtctggccattgttgatccagcttcaggtaag
caacccttgttcagtgaagataataaattggttttggccgctaacggcgaaatctataac
catagggaattgcgaaagcaattcgacggaaagtataattttcagaccgaatccgattgt
gaggtgattttggccctttaccaagaaaagggagccgatttccttgatgagatgaacggt
atatttggttttgccatctacgacaccgagaacgattcttattttgtggcccgtgaccat
atgggaattattccattgtatatcggatgggatcagaacggtactttctatgtagcttcg
gaattgaaagctttggaaggcacctgcaccaaaatagaactctttcctccaggacattat
ttgagcagtgaagatggggagttcaaaagatggtattcaagggactggatggagtacgat
gccgtaaaggaaaatgaaacaagcattcaagagatcaaggaagccttggaagcggcggta
caccgtcagttaatgtccgatgtgccttatggtgtgttgttgtcgggggggcttgattcc
tcggttacttcggccattgccaaaaaatacgctcagaaacgtatcgagtccggtgacact
accgatgcttggtggcctcagttgcattcgttctccgtaggtcttgaaggttcccctgac
ttggcggccgcccaaaaagtggcggaccatatcggtacggtacaccacgagatcaaattt
accattcaagaaggcttagatgctatcaaggatgtggtctataacttagagacctatgac
ataactaccattagggcctctacacctatgtaccttatggctagggtaatcaagtctatg
gggataaaaatggtgctttccggcgaaggggccgatgaacttttcggaggatacctttac
tttcacaaggcgccgaacgacaaagaatttcatgaggaaacggtacgtaagctaagcaaa
ttgcatatgtacgattgtctccgtgccaacaaatcgcttgcggcatggggtattgagggc
cgtgtgcccttcttggacaaagaatttatagatgtagccatgcgtatcaaccctaaagac
aagatgatcaatggcgaacgtatggagaaatgggtggtgagaaaggcttttgaggatatg
cttcccgaaagcgtggcatggcgtcaaaaagaacagttttcagacggtgtagggtacagt
tggatcgataccttaaaggaaatcgtgaacgaagaagtgaccgatgaacaattggccaac
gccaagttccgtttccctgtccaaaccccgacttcgaaagaggaattctactaccgttct
atttttgaatcgcactttccatccgatgcagctgccctatgtgttcctcaggaagcctcg
gtggcctgtagcacgcaaattgcccttgagtgggatgaagcttttaaaaacatgaacgat
ccatccggtagggccgtggcaaacgttcacgatgacgcctattag

DBGET integrated database retrieval system