KEGG   Zobellia galactanivorans: zobellia_2780Help
Entry
zobellia_2780     CDS       T01586                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zga  Zobellia galactanivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    zobellia_2780 (tpiA)
   01230 Biosynthesis of amino acids
    zobellia_2780 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    zobellia_2780 (tpiA)
   00051 Fructose and mannose metabolism
    zobellia_2780 (tpiA)
   00562 Inositol phosphate metabolism
    zobellia_2780 (tpiA)
Enzymes [BR:zga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     zobellia_2780 (tpiA)
Exosome [BR:zga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   zobellia_2780 (tpiA)
  Exosomal proteins of bladder cancer cells
   zobellia_2780 (tpiA)
  Exosomal proteins of melanoma cells
   zobellia_2780 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3251572..3252321
Genome map
AA seq 249 aa AA seqDB search
MRSKIVAGNWKMNKNLAETEALLTELAAKLPDTQAEVMVAPTFVNLAAAVRTLDSSVIEV
IAQNMHFAESGAYTGEISADMLLNIGIDTVIIGHSERRAYFGETDEILAKKVKAALAKNM
RVMFCFGEELDDRKSDNHFKVVESQLKNALFSLEASDWGKIVLAYEPVWAIGTGETASPE
QAQEMHAFIRKTITEAYDASIANNVSILYGGSVKPANAVEIFGKPDVDGGLIGGASLVAD
DFVAIIKAI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcaaaatagttgcaggaaactggaaaatgaataaaaacttggcagagacagag
gcgttgttgaccgaactggccgccaaattgcccgatacgcaagccgaggttatggttgcc
cctacctttgttaacttggcagctgccgtacgtactttagattcgtccgttatagaggtg
atcgcgcagaatatgcattttgccgaaagtggtgcctatacgggagagatttctgctgac
atgttgttgaatatcggcattgataccgttattataggacattctgaaagaagggcctat
tttggtgaaacagatgaaatattggccaaaaaagtaaaggcagctttggcaaagaatatg
cgagtgatgttttgttttggtgaagagcttgatgatagaaagtccgataaccacttcaag
gtggtcgaaagtcaattgaaaaatgcacttttctctttggaggcttccgattgggggaaa
attgtattggcttacgaaccggtttgggccatcggtaccggagaaaccgcttctcctgaa
caagcgcaggaaatgcatgcctttattcgcaagaccattaccgaagcctatgatgcttca
attgccaacaatgtttctattttatacggaggtagtgtaaaacctgccaatgcggtagag
attttcggaaaaccggatgttgatggtggacttatcggaggcgcttctttggtagctgat
gattttgtagctataatcaaggctatttag

DBGET integrated database retrieval system