KEGG   Zobellia galactanivorans: zobellia_2911Help
Entry
zobellia_2911     CDS       T01586                                 

Gene name
nahA2
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
zga  Zobellia galactanivorans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    zobellia_2911 (nahA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    zobellia_2911 (nahA2)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     zobellia_2911 (nahA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3392324..3393940)
Genome map
AA seq 538 aa AA seqDB search
MKSNLIKALFISCIFVALFSCEPEKKKRVLNLPQTDLAMEPMIPMPMKVIPTNSGFALDK
FTAIYTSENADGFPEVGRFLSEKIHAKTSLDIPVNTEDTPEREGVIYINQSDSLELNAPE
AYQLYITKDSIILNANTSTGAFRGVQTIRQIIPEIPNDTVAPYQVWNIPTGKIIDNPVFE
YRGSMLDVARHFFSVEDVKKYIDLLAYYKYNVLHLHLSDDQGWRIEIKSWPKLTEVGGST
EVGGKSGGFYTQEEYSDIVNYAAQRHMTIVPEIDMPGHTNAASVSYPFLNGNGKEVKLYT
GMRVGFSTFDTRKDTTYAFIDDVVREISAISPGPYFHIGGDESHVTKKKDYVYFVEKVEK
IVQKYGKRMIGWDEVATANIDSTSISQFWSSKENADLAVEKGMKIIMSPAKKAYLDMQYD
SLSKHGLHWAAYIPTDTAYEWSPETYEGVPLENILGIEAPLWSETISNIDELEYLAFPRA
IGYAELSWSTPENRDWEKYKVRLAQQAPFLDRMNVKYYPSPLIDWKKSEYTYKEIKKD
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaacttgatcaaagcattgtttatcagctgtattttcgtggcgctattttct
tgcgaaccagaaaaaaagaaacgcgtcttgaacctaccgcagaccgatttggccatggaa
cctatgatccctatgccgatgaaggtcattcctacgaattcaggctttgccttagataag
tttaccgccatatacacctcggaaaacgccgatggttttcccgaagtaggtcgatttctt
tccgaaaaaatacacgccaagacttccttggatatccccgtaaatacggaagatactcca
gaacgtgaaggcgttatctacatcaaccagtccgacagtttagaattgaacgcccccgag
gcctaccaactgtacatcaccaaagactccataattctaaatgcgaatacctcaacaggt
gcttttagaggggtacagaccattcgtcaaatcataccggaaataccgaacgataccgta
gctccgtaccaagtatggaacattcccaccgggaaaattatcgacaaccccgtttttgag
tacagaggaagtatgctcgacgtagcccgtcatttttttagtgtagaagatgtaaaaaaa
tatatagaccttctcgcctactacaaatacaacgtcttgcatttacacctatccgatgac
caaggttggcgtattgaaatcaaatcatggcccaaactcacggaagtaggaggaagcacc
gaagtaggaggaaaatcaggaggattctatacgcaagaggaatatagcgatattgtcaac
tacgcagcccaacggcatatgaccatcgtacctgaaatagacatgccaggacatacgaat
gcagcctccgtttcataccccttcttaaacggaaatgggaaagaagtaaaactatacacg
ggtatgcgagttggtttcagcaccttcgacacaagaaaagatactacctatgcctttatt
gacgatgtagtacgcgagatttccgctataagccctggcccctattttcatatcggtgga
gacgaaagccatgttaccaagaaaaaagactatgtgtactttgttgaaaaagtagaaaaa
attgtgcagaaatacggcaagcggatgatcggatgggatgaggttgctaccgcaaatata
gactccacctcaatttcccagttttggtcaagcaaagaaaatgccgacctagccgtagaa
aaaggaatgaaaattattatgtctccggcaaaaaaggcctatctcgacatgcaatacgac
agcctatctaaacacggactgcactgggccgcctatatccccacggatacggcctatgaa
tggtctcccgaaacctatgaaggggtacccctggaaaacattttaggcattgaagccccc
ttatggtcagaaaccattagtaacattgacgaactagagtacttggcatttccgcgtgcc
ataggttatgccgaattgagttggtcaacgcccgaaaaccgcgattgggagaagtataaa
gtccgtttagcccagcaagcccctttcttggatcgaatgaacgtaaaatactatccctct
ccattaatcgattggaaaaaaagcgaatatacctataaagaaatcaaaaaagattga

DBGET integrated database retrieval system