KEGG   Zobellia galactanivorans: zobellia_3132Help
Entry
zobellia_3132     CDS       T01586                                 

Gene name
rocD
Definition
ornithine aminotransferase (EC:2.6.1.13)
Orthology
K00819  
ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
zga  Zobellia galactanivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    zobellia_3132 (rocD)
Enzymes [BR:zga01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     zobellia_3132 (rocD)
Amino acid related enzymes [BR:zga01007]
 Aminotransferase (transaminase)
  Class III
   zobellia_3132 (rocD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3621604..3622848
Genome map
AA seq 414 aa AA seqDB search
MSVLEKITSEGAIALEDKYGAHNYHPLPVVLTKGEGVYVWDVEGKKYYDFLSAYSAVNQG
HCHPKIVKAMTDQAHTLTLTSRAFYNDMLGKYEKYATETFGFDKLLPMNTGAEAVETALK
VCRKWAYEKKGLNENEAQIVVCENNFHGRTTTIISFSNDPVARKNFGPYTAGFIKIEYDN
LEALAEVLEQNHNIAGFLVEPIQGEAGVYVPSEGYLRKAKALCEKHNVLFIADEVQTGIA
RTGKMLAVDHENVKPDILILGKALSGGAYPVSAVLANDEVMGVIKPGNHGSTFGGNPIAA
AVAIAALEVVKNEELAQNAETLGLLFRDELNKFIPNCNVVNGVRGKGLLNAILINDTEDS
STAWDICMALKENGLLAKPTHGNIIRFAPPLVMNREQLLDCVEIITTTLKRFEK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttttagaaaaaatcacttctgaaggtgctattgcattggaggataagtacgga
gcacacaactatcacccattgccagtggtactcactaagggagaaggggtttatgtttgg
gatgttgaagggaaaaaatattatgatttcctttcggcctactccgcagtaaaccagggg
cattgccacccgaaaattgtcaaggccatgaccgatcaggcgcataccttgacccttacc
tcaagggcgttttacaacgatatgctcggaaagtatgaaaagtatgccacggaaactttc
ggctttgacaagttgttgcctatgaacacaggtgccgaggccgttgagaccgcattgaaa
gtgtgccgaaagtgggcctatgagaaaaaaggcttgaacgagaacgaggcacagatcgtt
gtttgtgaaaacaattttcatggaagaaccaccacaatcatttcgttttcgaacgacccg
gtggcccgtaagaatttcggaccctatacggccggatttattaaaatagaatatgataac
ctagaggctttggccgaggtgcttgaacaaaaccataacatagctggttttttggtcgag
cctattcaaggggaggcgggagtatacgttccttctgaaggttatttaaggaaagccaag
gcattgtgcgaaaagcacaacgtactttttatagccgatgaggtccagaccggaatagcc
cgaacaggtaagatgctggcagtagaccatgagaacgtaaagcctgatatcttgatattg
ggaaaagcgctttctggaggagcttaccccgtttccgctgttttggccaacgatgaagtt
atgggggtgatcaaacctggaaaccacggcagtacttttggcgggaaccctattgctgcg
gccgtggccattgcggcattagaggtagtcaaaaatgaggagttggcgcaaaatgccgag
acactcggactactgttcagggatgagttgaacaaatttataccgaactgcaatgtggtg
aacggcgtaaggggtaaagggttgttgaatgcaattcttatcaatgatacggaagacagt
tcgaccgcatgggatatttgtatggccctaaaggaaaacggacttttggccaaacctacc
catggcaacattattcgctttgcaccgcccctggtaatgaacagggagcaactgttagat
tgcgttgagatcataacaacaacattgaaacggttcgagaaataa

DBGET integrated database retrieval system