KEGG   Zobellia galactanivorans: zobellia_3514Help
Entry
zobellia_3514     CDS       T01586                                 

Definition
GDSL-like lipase/acylhydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
zga  Zobellia galactanivorans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    zobellia_3514
Enzymes [BR:zga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     zobellia_3514
   3.1.2  Thioester hydrolases
    3.1.2.-  
     zobellia_3514
Lipid biosynthesis proteins [BR:zga01004]
 Fatty acid synthase
  Component type
   zobellia_3514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4047084..4047737
Genome map
AA seq 217 aa AA seqDB search
MKKQLFLIIALCAILVGFDQDNKPKVLIIGDSISLGYTPHVKSALKDKANVFHNKGNAQH
TGTGIEKLDEWLGDTQWDVIHFNWGLWDLCYRHPDAKTQGNRDKVNGTVTYTPEQYRDNM
EALVVRLKQTGAKLIFATTSYVPEGEVGRFVKSDKIYNKMAVEVMKKHGVTINPLNRISK
KVYKKHAAGPGNVHYTKEGYRLLSEPVVKYIEKSLGF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaactgtttcttattattgcgctttgtgcgattttagtaggttttgaccaa
gacaataaacccaaggtcttgattattggcgattccatttccttaggatatacgccccat
gtaaaatcggccttaaaagataaggccaacgtattccataataaggggaatgcccaacac
acgggaacgggaatcgagaaattagatgaatggctaggggatacccagtgggacgtgatt
catttcaattggggactgtgggatttgtgttaccgccatcccgatgcaaaaacgcaaggt
aacagggacaaggtaaacggtaccgtgacctatactccggaacaataccgcgataatatg
gaagccttggtcgttcgactgaaacagactggggccaaactgatttttgcgactacaagt
tatgtgcccgagggcgaggtaggtcgctttgtcaagtccgataaaatatacaataaaatg
gccgttgaagtcatgaaaaaacacggggtaaccataaatccgctaaatcgaatctcaaag
aaggtgtacaagaagcatgctgcaggtccggggaatgtgcactatacaaaagaaggctac
cgattactctccgaacctgtggtgaaatacatagaaaaaagcctaggcttttga

DBGET integrated database retrieval system