KEGG   Zobellia galactanivorans: ZOBELLIA_3514Help
Entry
ZOBELLIA_3514     CDS       T01586                                 

Definition
(GenBank) GDSL-like Lipase/Acylhydrolase family
Organism
zga  Zobellia galactanivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4047084..4047737
Genome map
AA seq 217 aa AA seqDB search
MKKQLFLIIALCAILVGFDQDNKPKVLIIGDSISLGYTPHVKSALKDKANVFHNKGNAQH
TGTGIEKLDEWLGDTQWDVIHFNWGLWDLCYRHPDAKTQGNRDKVNGTVTYTPEQYRDNM
EALVVRLKQTGAKLIFATTSYVPEGEVGRFVKSDKIYNKMAVEVMKKHGVTINPLNRISK
KVYKKHAAGPGNVHYTKEGYRLLSEPVVKYIEKSLGF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaactgtttcttattattgcgctttgtgcgattttagtaggttttgaccaa
gacaataaacccaaggtcttgattattggcgattccatttccttaggatatacgccccat
gtaaaatcggccttaaaagataaggccaacgtattccataataaggggaatgcccaacac
acgggaacgggaatcgagaaattagatgaatggctaggggatacccagtgggacgtgatt
catttcaattggggactgtgggatttgtgttaccgccatcccgatgcaaaaacgcaaggt
aacagggacaaggtaaacggtaccgtgacctatactccggaacaataccgcgataatatg
gaagccttggtcgttcgactgaaacagactggggccaaactgatttttgcgactacaagt
tatgtgcccgagggcgaggtaggtcgctttgtcaagtccgataaaatatacaataaaatg
gccgttgaagtcatgaaaaaacacggggtaaccataaatccgctaaatcgaatctcaaag
aaggtgtacaagaagcatgctgcaggtccggggaatgtgcactatacaaaagaaggctac
cgattactctccgaacctgtggtgaaatacatagaaaaaagcctaggcttttga

DBGET integrated database retrieval system