KEGG   Zobellia galactanivorans: zobellia_3514Help
Entry
zobellia_3514     CDS       T01586                                 

Definition
GDSL-like lipase/acylhydrolase
Organism
zga  Zobellia galactanivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4047084..4047737
Genome map
AA seq 217 aa AA seqDB search
MKKQLFLIIALCAILVGFDQDNKPKVLIIGDSISLGYTPHVKSALKDKANVFHNKGNAQH
TGTGIEKLDEWLGDTQWDVIHFNWGLWDLCYRHPDAKTQGNRDKVNGTVTYTPEQYRDNM
EALVVRLKQTGAKLIFATTSYVPEGEVGRFVKSDKIYNKMAVEVMKKHGVTINPLNRISK
KVYKKHAAGPGNVHYTKEGYRLLSEPVVKYIEKSLGF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaactgtttcttattattgcgctttgtgcgattttagtaggttttgaccaa
gacaataaacccaaggtcttgattattggcgattccatttccttaggatatacgccccat
gtaaaatcggccttaaaagataaggccaacgtattccataataaggggaatgcccaacac
acgggaacgggaatcgagaaattagatgaatggctaggggatacccagtgggacgtgatt
catttcaattggggactgtgggatttgtgttaccgccatcccgatgcaaaaacgcaaggt
aacagggacaaggtaaacggtaccgtgacctatactccggaacaataccgcgataatatg
gaagccttggtcgttcgactgaaacagactggggccaaactgatttttgcgactacaagt
tatgtgcccgagggcgaggtaggtcgctttgtcaagtccgataaaatatacaataaaatg
gccgttgaagtcatgaaaaaacacggggtaaccataaatccgctaaatcgaatctcaaag
aaggtgtacaagaagcatgctgcaggtccggggaatgtgcactatacaaaagaaggctac
cgattactctccgaacctgtggtgaaatacatagaaaaaagcctaggcttttga

DBGET integrated database retrieval system