KEGG   Zobellia galactanivorans: zobellia_3641Help
Entry
zobellia_3641     CDS       T01586                                 

Gene name
mroA3
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
zga  Zobellia galactanivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    zobellia_3641 (mroA3)
   00052 Galactose metabolism
    zobellia_3641 (mroA3)
Enzymes [BR:zga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     zobellia_3641 (mroA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4244029..4245132)
Genome map
AA seq 367 aa AA seqDB search
MKSYMYAVLICLCSIARLNSQHAGVKSEKWGVAQGKEVLLYTLTNENGMVVKITDFGGTI
TAIHVADKEGVFEDVVLGFDNLEQYKAEHPCFGATIGRVANRIRNARFEIDGTPYQLAQN
SNGHCLHGGNEFDRVVWQSKIVANKLGPSVQLHHLSKEGTMGFPGNLDSYVTYTLTDDDS
IHVHYEATTDKATHVNMTQHSYFNLNGGKDKIYDHIIKIDADNYTEIDEEIIPTGKLATV
KGTDWDLTSPTPIGKNIHKLNFNGYHYNYVFNKPNGELKEVIQVVEPKSGRTLSVFTTQP
GVQFYSGNTIGDTFTGKNDIRYSDHMAFCLETQHFPDTPNHPNFPSTLLLPGEKYDETTI
FRFGVEE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttacatgtatgccgttttgatatgcctttgctccatagctcggttgaattcc
caacatgccggcgtcaaaagtgaaaaatggggtgtggcccaaggtaaagaagtactattg
tacaccctgacaaacgaaaacggtatggtggtcaaaatcaccgattttggtgggaccata
accgctatacacgttgcggataaagaaggggtttttgaagatgtggtgctcggtttcgat
aatttagaacagtacaaggccgagcacccttgttttggggccacgattggacgcgtagcg
aaccgcatacgaaacgccagatttgaaattgacggaaccccctaccagctagcgcaaaac
agtaatggccattgcctgcacggcggcaacgaatttgaccgtgtggtatggcagtcgaaa
atcgtagcgaacaaactagggccctccgttcagttacaccacctatcaaaagagggcacc
atgggctttcctggtaatttagatagttacgttacctataccctgaccgacgacgattcc
attcacgttcattatgaagccactaccgataaggctacccacgtcaacatgacgcagcac
agctattttaatctgaatggtggaaaggataaaatttacgaccacatcatcaaaatcgat
gcggacaactataccgaaattgatgaagaaattattcctaccgggaaattggcgacggta
aaaggtaccgattgggacctaacttcccctaccccaataggaaagaacatccacaaattg
aatttcaacggctaccattacaattatgttttcaacaagcccaatggagaactcaaggag
gtaatacaagttgtagagcccaaatcgggcagaacactaagcgttttcacgacccaaccc
ggggtacaattctattcgggcaataccataggcgatacctttacgggaaagaacgacatc
cgatattccgatcatatggcgttttgcctagagacccaacattttcccgacacgcccaat
catcctaattttccttccacactattgcttccgggagaaaaatacgacgaaaccaccatc
ttccgttttggggtggaagagtaa

DBGET integrated database retrieval system