KEGG   Zobellia galactanivorans: zobellia_3699Help
Entry
zobellia_3699     CDS       T01586                                 

Gene name
phoD3
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
zga  Zobellia galactanivorans
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zga00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:zga02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4327849..4328898)
Genome map
AA seq 349 aa AA seqDB search
MSHKYIALCLIFITLGCKPQSHTSKDTPTTYLDSTVTADFTLAFGSCNKQDETNFLWDDI
LKTQPDVWVWGGDNIYADTDNMQRLRAMYDQQNAIEGYKKLKENTTVIGTWDDHDYGLND
GGVDFHKKKESQQEFLDFMGVEKNDPRRTQEGVYTSHTYKTPQGSIKVIVLDTRYFRTAL
TPDTKTKKRTKPNAYGDGTVLGERQLTWLSNELYDSTADFNVLVSSIQILSNEHGFETWG
NFPHEVDQLKKLIADSKAKGVMILSGDRHISEFSKTEIEGLPYPLIDFTSSGLTHSYTRF
KNESNPFRVGKVVSTKSFGLIRFNFKTKETHMQMLGDGLKLLGELHQVY
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaagtacattgccctttgcttgatttttataacccttggttgtaaaccacaa
agccacacctcaaaagacacgcccacaacctatttggatagcaccgttacggccgatttt
actttggccttcggctcttgcaacaagcaggacgaaaccaattttctctgggacgacatc
ctaaaaacccaacctgatgtatgggtctggggcggagataatatttatgcggataccgac
aacatgcaacggttaagagccatgtacgaccaacagaatgccatagaaggctacaagaaa
ctaaaggaaaacactaccgttataggtacttgggacgatcatgattacggacttaacgac
ggcggtgtagactttcacaaaaagaaggaaagccaacaagaatttttagactttatgggc
gttgaaaaaaatgatcccagaagaacacaggaaggcgtttatacttcacacacctataaa
acccctcaaggaagtataaaagtaatcgtactcgacacccgatattttagaacagcatta
acgccagacaccaagaccaagaaacgcaccaaaccgaacgcctatggtgatggcacggtt
ttgggcgagcgccaattgacatggctttccaatgagctttacgattcgacagccgatttc
aacgttctggtaagcagcatacaaatactatcgaacgaacacggctttgagacctggggc
aacttcccccatgaggtcgaccaacttaaaaaactcatcgcagattctaaggccaaagga
gttatgatcctctccggagatcgacatatttcggaattttccaaaacggaaattgaaggc
ctgccctacccccttatcgattttacgagtagtggacttacacattcgtatacccgattc
aagaacgagtccaatccgtttagggtcggaaaagtcgtctccacaaagagtttcggcctc
atccgatttaactttaaaaccaaggaaacacacatgcaaatgctcggtgacggcctaaaa
ctattgggagaactacatcaagtctattaa

DBGET integrated database retrieval system