KEGG   Zobellia galactanivorans: zobellia_3703Help
Entry
zobellia_3703     CDS       T01586                                 

Gene name
bglC
Definition
endo-beta-1,4-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
zga  Zobellia galactanivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:zga00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4331877..4332953
Genome map
AA seq 358 aa AA seqDB search
MKMIKLICAVVCMVLVGCDPNPDTEEVLVEDDVTVKAEDVSSEETDDCHDGDDTSKNTVV
AEYGQLSVDGKYMVNQDGEKVQLRGMSLFWSQWMGQFYTKEAVKWLKDDWNVSIVRASMG
VEDSDGYLSNPDKEKAKVFEVIDAAIEEGIYVLVDWHSHHAEDHLDEAKRFFAEVAEKYG
SHPNIIYETYNEPLGVSWTQVLKPYHEAVVAEIRKYDPDNIVVCGTRNWSQAVDEVVGNE
LNDPNVMYTLHYYASSHKEDLRNAAQVAIDNNIPLFVTEYGVTEYTGNGYIDVESVEQWW
KFLDDNSISWCNWSIADKEESSAALTPGASGQGGWSESQLTQSGRMVRAEILAKNPKF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgattaaattaatttgtgctgtggtatgtatggttttggtaggatgtgatccg
aatccggataccgaggaggtcttggtagaagacgatgttacggtcaaggcggaggatgta
tcttctgaagaaaccgatgattgccatgacggggacgatacttcaaaaaacacggtggta
gccgaatacgggcagcttagtgtagatggaaaatatatggtaaaccaagatggtgaaaaa
gtacaattgaggggtatgtctttgttctggagccagtggatgggccaattctacaccaag
gaggccgtgaaatggctcaaggatgattggaacgttagcattgtacgcgcctctatggga
gttgaggactcagatggttatctatctaatccagataaggaaaaagcaaaggtatttgaa
gtgatagatgcggccatagaagaaggtatctatgtcttggtcgattggcatagccatcat
gccgaagaccatcttgacgaggccaaacgattttttgccgaagtggccgagaaatacgga
tcgcatccgaatattatttatgaaacctataatgagcctttgggggtttcctggacacag
gtattaaaaccataccatgaagcggtagtggctgaaatcagaaagtacgaccctgacaat
atagtggtatgtggaacgcgaaactggtctcaagctgtagacgaagtggtagggaacgaa
cttaatgatcccaatgtgatgtataccttacattactatgcttcttcccataaagaagat
ttgcgcaatgcggcacaggtagccatagacaataatatacccttgttcgtaaccgagtac
ggtgtaaccgaatatacgggcaatggttatatcgatgttgaatcggtagagcaatggtgg
aagtttttagacgacaattctatttcttggtgtaattggtctatagccgataaagaggaa
agctcggctgcacttacaccaggggcgagcggtcaaggtggttggtctgaaagccagctt
acccaatcaggacgtatggtccgtgccgaaatattggcgaaaaaccctaaattttaa

DBGET integrated database retrieval system