KEGG   Zobellia galactanivorans: zobellia_3735Help
Entry
zobellia_3735     CDS       T01586                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zga  Zobellia galactanivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    zobellia_3735 (pfkA)
   01230 Biosynthesis of amino acids
    zobellia_3735 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    zobellia_3735 (pfkA)
   00030 Pentose phosphate pathway
    zobellia_3735 (pfkA)
   00051 Fructose and mannose metabolism
    zobellia_3735 (pfkA)
   00052 Galactose metabolism
    zobellia_3735 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    zobellia_3735 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    zobellia_3735 (pfkA)
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     zobellia_3735 (pfkA)
Protein phosphatases and associated proteins [BR:zga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     zobellia_3735 (pfkA)
Messenger RNA biogenesis [BR:zga03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     zobellia_3735 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4378467..4379453
Genome map
AA seq 328 aa AA seqDB search
MASEIKKIGVLTSGGDSPGMNAAIRSVVRTCAYMKVDCVGIYRGYQGMIEGDFKPMDARS
VNNIINKGGTILKSARCDGFRTPEGRKRAYEQLRAEGIDAFVVIGGDGSFTGAMVFNQEY
HFPIIGIPGTIDNDIFGTSNTVGFDTAMNTVVEVIDKIRDTASSHNRLFFVEVMGRDVGH
IALNTGVGAGAEEILIPEANRGLERLLESLKRSKKSGKSSSIVVVAEGDKIGKSVFELKE
YVEEHLPIYDVRVSVLGHMQRGGAPSCYDRVLASRMGVKAVESLLEGQTNFMVGVQNNKI
ILTPISKAIKGHTKIDKELIRVSEIMTT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagaaataaagaaaataggtgttttgacctccggaggtgattcccccggcatg
aatgctgcaatacgctccgtggttagaacttgtgcctacatgaaagtagattgcgtaggt
atctatagaggatatcagggcatgatcgagggggattttaagccgatggacgcacgtagc
gtcaataacataatcaataaaggaggaacgattctcaaatcggcccgttgtgatggtttt
agaacgcccgaagggcgcaaaagagcctatgagcaattaagggcagagggtatcgatgct
ttcgtggttatcgggggcgacggtagttttaccggagctatggtatttaaccaggagtat
cactttccgattataggtattccgggtactatcgacaacgatatattcggtacatctaat
acggtaggttttgatacggccatgaatacggtggttgaggtaatcgataagattagggat
accgccagctcgcataaccgacttttctttgttgaggttatgggtagggatgtaggtcat
atcgctttaaataccggcgttggtgcgggtgccgaagagatattgattcctgaggcgaac
cgaggtcttgagcgtttgctcgaatctttaaagcgtagtaaaaaatcgggtaagtcatct
agtatcgttgtggtggctgaaggtgataagatcggtaaaagtgtttttgaacttaaggaa
tatgttgaggaacacttacctatttacgatgtacgggtgtccgtattagggcatatgcag
cgtggaggggcgccatcttgttacgacagggtcttggccagtagaatgggagtgaaggcc
gtagaaagcttgttggaagggcagaccaactttatggtgggggtccagaacaacaaaatt
attcttacgccgattagcaaagctatcaaaggacatacgaaaatagataaggaacttatt
cgagtttcagaaataatgacaacataa

DBGET integrated database retrieval system