KEGG   Zobellia galactanivorans: ZOBELLIA_3735Help
Entry
ZOBELLIA_3735     CDS       T01586                                 

Gene name
pfkA
Definition
(GenBank) 6-Phosphofructokinase, isoenzyme 1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
zga  Zobellia galactanivorans
Pathway
zga00010  Glycolysis / Gluconeogenesis
zga00030  Pentose phosphate pathway
zga00051  Fructose and mannose metabolism
zga00052  Galactose metabolism
zga00680  Methane metabolism
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01120  Microbial metabolism in diverse environments
zga01130  Biosynthesis of antibiotics
zga01200  Carbon metabolism
zga01230  Biosynthesis of amino acids
zga03018  RNA degradation
Module
zga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
zga_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZOBELLIA_3735 (pfkA)
   00030 Pentose phosphate pathway
    ZOBELLIA_3735 (pfkA)
   00051 Fructose and mannose metabolism
    ZOBELLIA_3735 (pfkA)
   00052 Galactose metabolism
    ZOBELLIA_3735 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    ZOBELLIA_3735 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ZOBELLIA_3735 (pfkA)
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ZOBELLIA_3735 (pfkA)
Protein phosphatases and associated proteins [BR:zga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ZOBELLIA_3735 (pfkA)
Messenger RNA biogenesis [BR:zga03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ZOBELLIA_3735 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1 AIRC
Motif
Other DBs
NCBI-ProteinID: CAZ97873
UniProt: G0L819
Position
4378467..4379453
Genome map
AA seq 328 aa AA seqDB search
MASEIKKIGVLTSGGDSPGMNAAIRSVVRTCAYMKVDCVGIYRGYQGMIEGDFKPMDARS
VNNIINKGGTILKSARCDGFRTPEGRKRAYEQLRAEGIDAFVVIGGDGSFTGAMVFNQEY
HFPIIGIPGTIDNDIFGTSNTVGFDTAMNTVVEVIDKIRDTASSHNRLFFVEVMGRDVGH
IALNTGVGAGAEEILIPEANRGLERLLESLKRSKKSGKSSSIVVVAEGDKIGKSVFELKE
YVEEHLPIYDVRVSVLGHMQRGGAPSCYDRVLASRMGVKAVESLLEGQTNFMVGVQNNKI
ILTPISKAIKGHTKIDKELIRVSEIMTT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagaaataaagaaaataggtgttttgacctccggaggtgattcccccggcatg
aatgctgcaatacgctccgtggttagaacttgtgcctacatgaaagtagattgcgtaggt
atctatagaggatatcagggcatgatcgagggggattttaagccgatggacgcacgtagc
gtcaataacataatcaataaaggaggaacgattctcaaatcggcccgttgtgatggtttt
agaacgcccgaagggcgcaaaagagcctatgagcaattaagggcagagggtatcgatgct
ttcgtggttatcgggggcgacggtagttttaccggagctatggtatttaaccaggagtat
cactttccgattataggtattccgggtactatcgacaacgatatattcggtacatctaat
acggtaggttttgatacggccatgaatacggtggttgaggtaatcgataagattagggat
accgccagctcgcataaccgacttttctttgttgaggttatgggtagggatgtaggtcat
atcgctttaaataccggcgttggtgcgggtgccgaagagatattgattcctgaggcgaac
cgaggtcttgagcgtttgctcgaatctttaaagcgtagtaaaaaatcgggtaagtcatct
agtatcgttgtggtggctgaaggtgataagatcggtaaaagtgtttttgaacttaaggaa
tatgttgaggaacacttacctatttacgatgtacgggtgtccgtattagggcatatgcag
cgtggaggggcgccatcttgttacgacagggtcttggccagtagaatgggagtgaaggcc
gtagaaagcttgttggaagggcagaccaactttatggtgggggtccagaacaacaaaatt
attcttacgccgattagcaaagctatcaaaggacatacgaaaatagataaggaacttatt
cgagtttcagaaataatgacaacataa

DBGET integrated database retrieval system