KEGG   Zobellia galactanivorans: zobellia_3864Help
Entry
zobellia_3864     CDS       T01586                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
zga  Zobellia galactanivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    zobellia_3864 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    zobellia_3864 (glkA)
   00052 Galactose metabolism
    zobellia_3864 (glkA)
   00500 Starch and sucrose metabolism
    zobellia_3864 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    zobellia_3864 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    zobellia_3864 (glkA)
   00524 Butirosin and neomycin biosynthesis
    zobellia_3864 (glkA)
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     zobellia_3864 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4549120..4550193)
Genome map
AA seq 357 aa AA seqDB search
MKMIEGRSFPILRNSLIPLAIGSRKNLGHKNGIVLAGDIGGTKTNLALFEYKDGHLSPLK
QNSYKTKDYNSLLEIIHEFEVKEITPIDSMCFGVAGPITNGKVYGTNFPWGIDAQELTRE
LHLRSVFLINDMQANAYGLAALGEKDLDPLKYGSQIEGNAVIISPGTGLGEAGLYWDGKA
YHPFASEGGHCDFSPRNDFDYEIWKYFQQKYGHVSWERLLSGQGIRDTYQLIRNVSGEKE
SDAFKAKMAKEDPAAVITKTAIEGTDPVCMETLDLFVRFLAIETSQLALKFKATGGIFIG
GGIMPKIIKGMNREAFNDNFMQSGRLNSLLQMVPVNVILNDNTALLGAGYYAAMSLE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgatagaaggacgctcttttccaatactccgaaattccctaataccattggcc
atagggtcccgaaagaacctaggccataaaaacggcattgtattggccggggacataggg
ggcacaaaaaccaatctcgccctttttgaatacaaagacggccatctttcccccttaaaa
caaaactcgtacaaaaccaaagactacaattccttactcgagatcatacatgagtttgaa
gtaaaggaaataaccccaatcgatagtatgtgttttggtgtagcggggcccataaccaat
ggcaaggtgtacggtactaatttcccctggggcatcgatgcccaagaactgacccgtgaa
cttcaccttagatccgtttttctaataaacgatatgcaggccaatgcttatggtttggcg
gccttaggggaaaaagaccttgaccccttaaaatacggctcgcaaatagagggtaatgcc
gtgattatatccccgggcacaggcttaggggaagccggtctgtattgggacggcaaggcc
taccacccctttgcctccgagggcggtcattgcgattttagcccgagaaatgatttcgat
tatgagatttggaagtactttcagcagaaatatggccatgtaagctgggaacgcctatta
tcgggacaaggcattcgcgatacctatcagctcattcgcaatgtcagtggtgaaaaggaa
tccgatgcctttaaggcgaaaatggccaaggaagaccctgcggccgtaattaccaagacc
gctatagaagggacagatccggtctgtatggaaacccttgatctttttgtccgctttttg
gccatagagacttctcaactagccttaaaattcaaggctaccggagggatttttattggt
gggggcatcatgcccaaaataataaagggaatgaaccgggaagcattcaacgataatttt
atgcaatcgggacgtttaaactcccttttgcaaatggttcccgtaaacgttattctcaac
gacaatacggcattgctcggagcaggctactatgcggccatgtcacttgagtaa

DBGET integrated database retrieval system