KEGG   Zobellia galactanivorans: ZOBELLIA_3866Help
Entry
ZOBELLIA_3866     CDS       T01586                                 

Gene name
pfkB
Definition
(GenBank) 6-Phosphofructokinase, isozyme 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
zga  Zobellia galactanivorans
Pathway
zga00010  Glycolysis / Gluconeogenesis
zga00030  Pentose phosphate pathway
zga00051  Fructose and mannose metabolism
zga00052  Galactose metabolism
zga00680  Methane metabolism
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01120  Microbial metabolism in diverse environments
zga01130  Biosynthesis of antibiotics
zga01200  Carbon metabolism
zga01230  Biosynthesis of amino acids
Module
zga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
zga_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZOBELLIA_3866 (pfkB)
   00030 Pentose phosphate pathway
    ZOBELLIA_3866 (pfkB)
   00051 Fructose and mannose metabolism
    ZOBELLIA_3866 (pfkB)
   00052 Galactose metabolism
    ZOBELLIA_3866 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    ZOBELLIA_3866 (pfkB)
Enzymes [BR:zga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ZOBELLIA_3866 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: CAZ98004
UniProt: G0L2A1
Position
complement(4551279..4552220)
Genome map
AA seq 313 aa AA seqDB search
MAQIITLTVNPAIDKSTTVAGMSPNTKLRCAEPSYDAGGGGINVSRAIRKLGGTSLCSYF
AGGPTGEFLKKLLTEQNIEQSVIPIEGWTRENLAVTDTTTNQQYRFGMPGPPVKEVEWKS
ALTQLEQRLHEGDYLVASGKLPPHVPEDFYLKVGRMAEKKGVRFILDTSGEALMEAAKSK
VYMLKPNLAELGALCGVASITDLDLKPLAQQFLERHDCEVLVVSLGPKGALLATKNTMEQ
IPAPVVHQKSTIGAGDSMVAGMVMSLIWGKPLSDMVRYGVACGTAATMHHGTQLCHKEDA
DRLYDWIKGQKPI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaataatcacacttaccgtaaaccctgcgattgacaaaagcactaccgtggca
ggcatgagccctaacacgaaattacgctgtgccgaacccagttatgatgccggtggcgga
ggcataaacgtatcacgggccattcgaaaattagggggaacatcactttgtagctacttt
gcaggtgggccaacgggagaatttttaaaaaagctcttaaccgaacaaaacatagaacaa
tcggtaattcccattgagggatggacccgtgaaaaccttgcggtaaccgataccactacg
aaccagcaatatcgatttgggatgccgggtccgcccgtaaaggaagtagaatggaaatct
gccttaacgcaactcgaacaacgactccatgaaggagactatttggtggccagtggaaaa
cttcctccccatgtaccagaggacttctatttaaaagtaggtcgcatggccgaaaaaaaa
ggagtccggtttattcttgacacttcgggcgaagcgcttatggaagccgctaagtcaaaa
gtttatatgttgaagcccaatttggccgaactaggggccctatgtggggtggcttctata
accgatttagacttgaagcccttggcccaacagtttttagagcgtcatgattgcgaagtt
cttgtcgtttccttagggccaaaaggcgctttattggccacaaaaaatacaatggaacag
atacctgctcccgtggttcatcaaaaaagtaccattggtgccggagatagtatggttgcc
ggaatggtcatgagcttgatatggggcaaacccttgagcgatatggtcagatacggcgta
gcctgcggaactgccgctaccatgcaccacggtacccaactctgtcataaggaagatgca
gaccggctttatgattggataaaaggacaaaaacctatttaa

DBGET integrated database retrieval system