KEGG   Zobellia galactanivorans: ZOBELLIA_3867Help
Entry
ZOBELLIA_3867     CDS       T01586                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
zga  Zobellia galactanivorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZOBELLIA_3867 (gpmA)
   01230 Biosynthesis of amino acids
    ZOBELLIA_3867 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZOBELLIA_3867 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    ZOBELLIA_3867 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZOBELLIA_3867 (gpmA)
Enzymes [BR:zga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ZOBELLIA_3867 (gpmA)
Exosome [BR:zga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ZOBELLIA_3867 (gpmA)
  Exosomal proteins of melanoma cells
   ZOBELLIA_3867 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4552252..4552941)
Genome map
AA seq 229 aa AA seqDB search
MGKLILVRHGKSLWNVKNVFTGWTDIDLAPEGMEEARKAGELIKSNLIEIDLCFSSYLKR
AIRTAWIILETAEMMHVDTRYSWKLNERHYGDWQGKNKDEVLKEVGEAFFLSVRRGYDTP
PPSLSNTDKRNPEFDSNYKALDTSVLPLGESLKDTSKRVVNYFFEAIAPELAKGKTILIA
AHGNSLRALIEYLEHISSDEIAKVEVATGVPHMYAFDDKLNITEHYPLR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattaatattggtcaggcacggaaaaagtctttggaacgtaaaaaatgttttt
acgggatggacggacattgacttggcaccggaaggtatggaagaggccagaaaagccggg
gaactgataaaatccaaccttattgagatagacctttgtttctcctcctatctaaaaaga
gccatccgcacggcctggatcatattggaaacggcagagatgatgcacgtagacacccgc
tatagctggaagttgaacgaaagacattatggcgattggcagggaaagaacaaggacgaa
gtgctaaaagaggtaggtgaagccttctttttaagcgttcgtagaggttacgatacgccc
cctcccagcctttccaacaccgataaaaggaatcctgaattcgattctaattataaggcc
ttggacacctctgttttacccttgggcgaatcgcttaaggatacttcaaaacgagtggtc
aattacttttttgaggccattgcacctgaattggccaagggcaaaaccatattgattgcc
gctcacggaaattcattacgggcccttatcgaatatttagaacatatttcatccgatgag
atcgccaaagtagaagtggccacgggtgtaccccatatgtacgcctttgacgataaactc
aatattaccgagcactacccattacgataa

DBGET integrated database retrieval system