KEGG   Zobellia galactanivorans: zobellia_3886Help
Entry
zobellia_3886     CDS       T01586                                 

Gene name
cgaA
Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
zga  Zobellia galactanivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    zobellia_3886 (cgaA)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     zobellia_3886 (cgaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4568344..4570716)
Genome map
AA seq 790 aa AA seqDB search
MSKNGEAPGAPGIEARWSSSTKSGIGKALNSASDVTFTLSHGILNEAYYPREDIACIRDM
GLIVTDGHGFFSEEKRDTEHFTKTIEEGIPAYHIVNSDPSGKFKITKEIIADPFRNTILQ
RIRFEANHPEPPLQLFALLAPHLNNEGGNNSGWLGEYKGVEMLFAKNGDIAVAMACSTKW
LHRSVGFVGTSDGWTDLHQHGKLKWQYERASRGNIALTGEIDLSENDFVLAISFGRTHLE
AANHARSSILNGFNSAKRRYVQEWQTWQNTLPKISAKNFKTSAATLRMHEAKNFPGGIIA
SLSIPWGNTKGDSDKSGYHVVWPRDLVESAGGFNALETKADISRIVNYLMSTQNADGSWP
QNMWLQGEPNWTGIQMDQIALPILEMLKGYLRNTIGKNRMKRYWPLAKKALTFLLINGPY
TDQDRWEEESGFSPFTMATEIAALLAGAELAEINGEETLAAYCRETADTWNDTIEYRTYV
TGTPLAQKHGVDGYYIRINPFADIPAAELGDRTINLKNHHFDHGKTPINELISVDALALV
RFGLRAPDDQRILNTLKVIDAELKVDTPNGSCWYRYNNDGYGEHENGDPYDGTGKGRAWP
LLTGERAHYEIAAGHIESARKLLNAMDAFANNGLLPEQIWDKDDIPEKGLYRGRHTGSAM
PLTWAHAEYIKLCISIDHKKVFDMPEQTCERYLRKNTVSDYQVWRFDNGTRVLPKGKTLR
IETLADCTLHWTDDHWKTTYQTQAKHLNIGLFITDIQPCHKEATSLEFTFYWKEAKKWEC
KNFSVRIENE
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaacggagaagcaccaggtgctccaggaattgaggccagatggagctctagt
acaaaatcaggaatcggaaaggccctaaattcggcttccgacgtaactttcacccttagc
cacggtattctgaacgaagcctactacccacgtgaagatattgcctgtatacgtgatatg
ggactcatcgttacggatggacatggatttttttctgaggaaaaaagagatacggaacac
tttacaaaaacaatcgaagaaggtattcccgcctatcatatcgtcaatagcgatccctcc
gggaaatttaagattaccaaggaaatcattgccgatccttttcgcaatactattctgcaa
cgtataaggttcgaagcaaaccatcccgaacccccattacaattattcgcattgctcgca
ccccatttaaacaatgaagggggcaacaactcgggctggcttggcgagtataagggggtt
gaaatgctatttgccaaaaatggcgacatagccgtagccatggcctgttccaccaaatgg
ctgcatcggtccgtcggctttgtaggtacttcggacggatggacagatttacaccaacac
ggtaagttaaaatggcaatatgagcgtgcttcgcgtgggaatatcgcccttaccggcgaa
atagacctaagcgaaaatgactttgttttggccataagttttggccgcacccatttagag
gcggccaaccatgccaggtcgagtatcctaaacggttttaactcggcaaaaagacgatat
gtacaagagtggcaaacctggcaaaataccttgcccaaaatatctgccaaaaattttaag
acaagcgccgctaccctacgtatgcacgaggccaaaaactttcccggcggcattatagcg
agcctttccattccttggggaaacacaaagggagactccgacaaaagcggttaccacgtt
gtatggccccgtgacctcgtggaaagtgccggtgggttcaacgcccttgaaaccaaggcg
gacatatcgcgtattgtaaactatctgatgtctacccaaaatgccgatgggagttggccg
cagaatatgtggcttcaaggggaaccgaactggaccggtattcaaatggaccaaattgcc
ttgcctattttggaaatgctcaaaggttatttgcgcaacaccataggaaaaaatcgtatg
aaacgatattggcccttggccaaaaaggcccttaccttcctattgataaacggcccttat
accgaccaagaccgatgggaagaagaaagtggcttttcgccctttaccatggccacagaa
attgccgccttattggccggggcagaactggccgagataaacggggaagaaaccttagcc
gcctattgtcgcgagacagccgatacttggaacgatactatcgaataccgaacctatgtt
accggtacgcccttagcacaaaaacatggggtagacggctattacatccgtatcaatccc
tttgccgatattcccgctgccgaattgggggacagaacgatcaatttaaaaaatcatcat
tttgaccatggcaaaacgcccattaacgaactgatcagcgtagacgcattggccttggtc
aggttcggccttcgtgcacccgatgaccaaagaatcttaaataccctaaaagtaatcgat
gccgaactaaaagtcgacacccccaatggcagctgttggtaccgttacaataatgacggc
tatggggaacatgaaaacggcgacccttatgacggtacgggaaagggtcgggcatggccc
ctattgacaggagaaagggcccattatgaaatcgccgcgggccatatcgaatcggcccgg
aaactcctaaacgctatggatgcctttgccaataacggcttactgcccgaacagatatgg
gacaaagacgatatacccgaaaagggactatatcgcggtaggcatacagggtcggcaatg
cccctgacatgggcccatgccgaatacatcaaactctgtatttctatagaccataaaaag
gtatttgatatgcccgaacaaacctgtgaaaggtatttgcgcaaaaacaccgtatcggat
taccaagtgtggcgatttgataacggaacccgtgtcttacccaagggaaaaacattacgg
atcgagaccttggccgattgtacccttcattggacggacgaccattggaaaaccacctat
caaacgcaggcaaagcaccttaatatcggactatttatcaccgacattcagccctgccac
aaagaggccacatccttggagttcacattttattggaaagaagcgaagaaatgggaatgc
aaaaatttttcggtgcgtattgaaaacgaatga

DBGET integrated database retrieval system