KEGG   Zobellia galactanivorans: zobellia_3901Help
Entry
zobellia_3901     CDS       T01586                                 

Definition
two-component system hybrid-sensor histidine kinase/Chemotaxis proteins (EC:2.7.13.3)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
zga  Zobellia galactanivorans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:zga00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    zobellia_3901
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    zobellia_3901
Enzymes [BR:zga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     zobellia_3901
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     zobellia_3901
Two-component system [BR:zga02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   zobellia_3901
Bacterial motility proteins [BR:zga02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    zobellia_3901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4591991..4595971)
Genome map
AA seq 1326 aa AA seqDB search
MTQPTSPSTENQHIKSQKNEFSIIGVGASAGGLEALKSFFEDLPAKFAHSFVVVQHLSPD
YKSLMGELLSKNTDMPIIEVKKKTKVEPGTIYLLTPKKNIFVKDGHLLLENKPTDRTLNL
PIDLFFKSLAREKTNKAIAVILSGTGSDGTSGARDIKEFGGMVMVQDPEQAEFESMPQNA
INTHLVDYVLPTEQMGEELQRFMQHPAVYGSLEESILKDEETLIKILNFVNSQTKLDFEY
YKRPTLIRMIARRIGVKRLDSLQEYKDFLLERPEEAHFLIREFLVGVTSFFRDDTVWDLL
TNEIIPKLIYDKKKNDTIKCWCVGVSSGEEAYSLAIIINEELAKQNKKNLVKIFATDIEK
NHLKDGSKGIYNESSVSNIPEKRLLANFTKKGDSYHINENIRRMVIFSKHNVLKDPPFNK
MDISFCRNMLIYLQPAAQNKVLDVLHYSLNRNGILVLGSSESLSRQKNAFEELHRKQKIY
RNIRPAKILGLQPYNSKNTLRNSFGTETIGYERNTKQFIVEALSDNLHLASIVIDSNFNI
VDAYGELSNYISLPNKGFSMNLLKMVPESIAMVLSYSIRKVGTTNQKLKHENLNFSTGKE
PVMANMHVASFQNPLNSNPSNFLVIIKPVELQSSHTLVLEETNVVPKNTRERELESELKE
TRESLKNMIEEVETSNEELQATNEELLASNEELQSTNEELQSVNEELHTVNAELQEKIEE
LAMLNSDLDNLFKSTDIGTVFLDKELRIRKFTPSVAKHFNLLENDVNRPLEHFASSFHKN
NYKEFISDIKSVIINHVPKESEVKDAKGQWFLQKIVPFQDGGGNVAGATLSYVDINKLKS
AEQRLQNQQLAIEQTTDSFWDLNIADNTYYVSHSIAEVLGYHKDEIEETIEFWSALAHPG
DLKIQIEAMQKHIDSQGKEPYAVETRYKHKLGHYVTLLLRGKIMEWTEDGQPKRMIGTTT
DVSMLKKLPKLEQDLLDRNMVFEQVLEITMAGFWDWNIAENSEYLSPTFKKMFGYDEHEM
TGSAESWQRIVHPDDLPGVLEKLDAHVKSKGEIPYDNEIRYFHKNGSIVWVWCKGLVIEW
GENGEPKRMVGSHINITQLKQLSRSNKELERFAYVASHDLQEPLRTIRDFVALFKDEYNT
LLDNRANTYLEFIEEASSRMGELVKVILAYSKIGSNTKKEIVNLKEVVENVQKDLQIRID
STKTKILIKELPTLTGHRVELHSLFLNLIGNSIKFISKDESPRIEIGTLTCEKGEHIYIR
DNGIGIDKKNQEHIFQVFKRLHNQEDYEGTGIGLAHCKKIVELHNGKIWVESEMGKGSTF
HFNLNL
NT seq 3981 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacctacctccccaagcactgaaaatcagcatattaaatctcaaaaaaacgaa
ttttcaataataggcgtcggagcaagtgcaggaggattggaggctttaaaatcatttttt
gaggatctacccgccaaatttgcccatagctttgtggttgttcaacacttgagccccgat
tacaagagtcttatgggggaactcttgtctaaaaacaccgacatgcccataatcgaggtc
aagaaaaagaccaaggtcgaacctggtacgatctatcttttaacccctaaaaaaaatata
ttcgtcaaggatggacacctgctcttagagaacaagcccacggatagaaccttgaacctt
cctatcgatttattcttcaagtccttggccagggaaaagacgaacaaggccattgccgta
atcttaagcggaacaggtagtgacggaacctctggggcaagggacattaaggaattcggt
ggaatggttatggtacaggaccccgaacaggccgagtttgaaagcatgccgcaaaatgcc
attaacacccatttggtagactatgtcttacctaccgaacaaatgggggaagaactacaa
cgcttcatgcagcaccctgccgtatacggatctctcgaagaaagtattttaaaggacgag
gagacccttattaagattttgaactttgtaaacagtcagaccaaattagactttgaatac
tacaagaggcctactttaatccggatgattgcccgaagaattggtgtaaaacgcctagat
tcccttcaagaatacaaagatttcctattggaaagacctgaagaagcccactttttgata
agggaatttttggtcggggtaaccagtttttttagggatgatacggtttgggatcttttg
accaatgaaatcatccccaaattaatttacgataaaaagaaaaatgacaccataaaatgt
tggtgtgttggggtaagcagtggcgaagaagcctattccttggctataattatcaacgag
gagctcgccaaacaaaataaaaaaaacctggtcaaaatttttgctaccgatattgagaaa
aaccacctcaaagatggctctaaaggcatatataacgaaagttcggtttcaaacattccc
gaaaagcgtttacttgcaaatttcacgaagaaaggtgatagttaccatattaatgagaac
ataaggcgtatggtcatttttagcaagcacaatgtgctaaaagaccctccttttaataaa
atggatatttccttttgccgaaatatgctcatttatttgcaacccgccgcccaaaataag
gtgctcgatgtattgcactactcgctaaacaggaacggcattctagtacttggaagcagt
gaatctttgagcaggcaaaaaaatgcttttgaggaattacatcgaaaacaaaaaatatac
cgcaacatacgaccagccaaaattttagggcttcaaccctacaattcaaaaaatacacta
agaaattccttcggcacggaaaccataggctatgagcgaaatacaaaacagtttatagta
gaggctttaagtgacaatctacacctagcttccatcgtaatcgatagcaatttcaacatt
gtggatgcttatggggaactgagcaactacatcagcctacctaacaaaggcttcagtatg
aatcttttaaaaatggtgcctgagagtatagctatggtgttgagctactctataagaaaa
gtaggcactaccaatcaaaaacttaaacatgaaaatctaaatttttcaacgggtaaagaa
cctgtgatggccaatatgcacgtggcttccttccagaatcccttaaacagcaacccctcg
aattttttggtgatcataaagcctgttgaactacaatcttcccacactttagtgctcgaa
gaaaccaatgttgtcccaaaaaacacaagagaacgcgaactagagtccgaattgaaagaa
actagggagagtcttaaaaatatgatcgaagaggtagagaccagcaatgaagaattgcaa
gctaccaatgaagaactcttagcctcaaacgaagagttacagagcaccaatgaagagttg
caaagtgtaaacgaggagctacataccgtaaatgcggaacttcaggaaaaaatagaggaa
ctagcaatgcttaattcagatttggacaacctttttaaaagtacggatataggcaccgta
tttttagataaggaactgagaatacgaaaattcacccctagcgtagctaagcactttaat
ctattagaaaacgatgtcaatagacctctcgaacacttcgccagctcgtttcacaagaac
aactataaagagttcatctcagatattaaatccgtaataatcaaccatgtccctaaagaa
agtgaagtaaaagatgccaagggccaatggttcttgcaaaagatcgtgccttttcaagat
ggtggaggaaatgtggccggagctaccttaagctacgttgacatcaacaaacttaaatcg
gcggaacaacgcttgcaaaaccaacaacttgccattgaacaaaccaccgatagtttttgg
gacttgaacatagccgataatacctattatgtaagtcattcaattgccgaagttctgggt
taccataaggatgaaatcgaagaaactatcgagttttggagcgccttggcccatcctggc
gatttgaaaattcaaatagaggccatgcaaaagcatattgactcacaaggcaaggaaccc
tatgcggtggaaacaagatacaaacataaattgggccattatgttaccttactattaaga
ggtaaaattatggagtggacagaagacggacagcccaaaagaatgataggcaccacgacc
gatgtttccatgctcaaaaaattgcctaaactggaacaggacctactcgaccgaaacatg
gtctttgaacaggtgttggaaataaccatggccggtttctgggactggaacattgccgaa
aacagcgaataccttagccctacctttaagaaaatgttcggttatgatgaacatgaaatg
acgggctccgctgaatcatggcagagaatcgtacacccggacgatttgcccggtgtactc
gaaaaacttgatgcccatgtaaaaagtaagggggaaataccttacgataatgaaatcagg
tacttccacaaaaacggcagcattgtatgggtatggtgcaaaggcttggtcatagaatgg
ggcgagaacggcgaacccaagagaatggtgggcagccacatcaacataacccagttaaag
caactatcgcgaagcaataaggagctagagcgctttgcttatgtggccagccacgacctg
caggaacctttacgtacgatacgtgattttgtagcattgttcaaagatgagtacaatacc
cttctcgacaatagggccaacacttatctcgaatttatagaagaggcctcctcaagaatg
ggcgaattggtaaaagtgattttggcctattcaaaaatagggagcaacaccaaaaaagaa
atcgtaaatttaaaagaggtagtcgaaaacgtgcagaaagaccttcaaatccgtatcgac
tccaccaaaaccaaaattcttattaaggaactgcctaccctaaccggacatagggtcgaa
ctgcattccctttttcttaaccttatcggcaattccataaaatttataagcaaagatgaa
agtcccagaatagaaatcggcaccctaacttgtgaaaagggggaacatatttatataagg
gacaatggaataggaatagacaaaaaaaaccaagaacacatttttcaagtatttaaaaga
ttgcacaaccaagaagattatgaaggtaccggaataggtctggcacactgcaaaaagatc
gtagagcttcataacggaaaaatttgggtggaatcagaaatgggaaagggaagtaccttt
cactttaacttaaatctataa

DBGET integrated database retrieval system