KEGG   Zobellia galactanivorans: zobellia_3952Help
Entry
zobellia_3952     CDS       T01586                                 

Gene name
xynB
Definition
endo-beta-1,4-glucanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
zga  Zobellia galactanivorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4651240..4652436
Genome map
AA seq 398 aa AA seqDB search
MLKTRGIKLRTIRLLGLLLLMSMGCKEKESSENTSLDIKSDTKEIPLKTAFKDQFKMGSA
INGAVVSGKDATSLQIVTQEFNTITPENCMKAESVSPARNVYNFEEADAFVAFGQEHNMF
IVGHTLIWHNQTPDWFFTNENGAPNSPEEQKEQLRKHIEAVAGRYAGKVHAWDVLNEVMD
NDGSYRPTNWIQYIGDGDEMVKLAFKYASEYAPDTELYYNDFNAWRPEKRDGIVRMVKML
QEEGIRIDGIGIQGHWGLNFPKNDYIQQAIDAYAALGVKVMITELDVDVLPLTKEGQIIG
TSMMEPQFQLEEFESFLDPYKEGLPDSVSVELAARYKELFEIFLKNRDKIDRVTLWGVHD
GLSWKNGYPIPNRTNYPLLYDRDKKPKLAKEAILETVK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaacaagaggtattaagctaaggaccattcggctgctaggtcttctgttgctg
atgtcaatgggctgcaaggaaaaggaaagtagtgaaaacacgagcttggatataaagtcc
gataccaaggaaatccccctaaaaacagcctttaaggaccaatttaagatggggtccgcc
ataaacggggcggtggtttcggggaaggatgcgacctcgctacaaatcgtaacccaagag
ttcaatacgattacgcccgagaattgtatgaaggcggaatccgtgagcccggcacgcaat
gtgtataattttgaggaagcggatgcgtttgtggcctttggtcaggaacacaacatgttt
atcgtaggccataccttgatctggcataaccagactcccgattggttttttaccaatgaa
aatggagcgccgaattcgcccgaggagcaaaaggagcagctccgaaagcacatcgaagcc
gtagccggaagatatgcgggaaaagtgcatgcctgggatgtgctcaatgaggttatggac
aatgatggctcttataggcccacgaactggatacaatatataggcgatggggatgaaatg
gtaaaattggcctttaagtacgccagtgaatacgcccctgacaccgaactttattacaac
gattttaatgcatggcgacccgagaagagagacgggatcgtacgtatggtaaagatgttg
caggaggaaggtatccgaatagacggaataggtattcaaggccattggggactcaacttt
cccaagaacgattacattcaacaagccatagacgcctatgccgccctgggggtgaaggtg
atgataaccgagttggatgtagacgtgcttcccttgaccaaggaaggccagatcattggc
acaagtatgatggaaccccaatttcagttagaggagtttgaatccttcctagacccctat
aaagaagggcttccggattcggtttcggtggaattggccgcccgttacaaggagcttttt
gagatcttcctaaagaaccgcgataaaatcgatagggttaccctttggggcgtacatgac
ggattgtcttggaagaatggctatcccatccccaatagaaccaattatccccttttgtat
gaccgggacaaaaaaccaaaattggccaaagaggccattttagaaaccgtaaaataa

DBGET integrated database retrieval system