KEGG   Zobellia galactanivorans: zobellia_3967Help
Entry
zobellia_3967     CDS       T01586                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
zga  Zobellia galactanivorans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:zga00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:zga00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4665296..4666603
Genome map
AA seq 435 aa AA seqDB search
MGTFKIEGGHQLSGEITPQGAKNEALQILCAVLLTNDTVTIHNIPNIVDVNKLIALLEDL
GVKIQKKAKGSYSFKADDINLDYLQSDQFKEDGRGLRGSIMLVGPLLARFGKGYIPKPGG
DKIGRRRLDTHFEGFIKLGAKFRYNKEEYFYGVEAKKLKGTYMLLDEASVTGTANILMAA
VLAEGKTTIYNAACEPYLQQLCKMLNRMGAKISGVGSNLLEIEGVESLGGTDHTMLPDMI
EIGSWIGLAAMTKSELTIKNVSWNDLGQIPTVFRKLGITLEKKGDDIFIPAHTNGYEIQN
YIDGSILTIADAPWPGLTPDLLSIILVVATQAKGEVLIHQKMFESRLFFVDKLIDMGAKI
ILCDPHRATVIGHDFKSTLKATTMVSPDIRAGVSLLIAALSAKGTSTIHNIEQIDRGYED
IDTRLRAIGAKISRV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggtacctttaaaattgaaggcggtcaccaactctctggtgaaatcacgccacaaggc
gctaaaaacgaagccttacaaatactatgtgccgtattgcttaccaacgacactgttacg
atccacaacattcctaatatagtagatgtcaataaactgatcgcattgcttgaagatttg
ggcgtaaaaatccaaaagaaggcaaagggatcgtacagctttaaggctgacgacatcaat
ttagattacctacagtcggaccagtttaaggaagatggtcgcggacttcgtggatctatt
atgttggtcggacctttgttggcgcgttttggaaagggatacatccctaagcccggcggt
gataaaatcggtaggcgtcgtttggatacccattttgaaggatttataaaattaggggcc
aagttcagatataacaaggaagaatacttttacggggtcgaggccaaaaaattaaagggc
acctatatgttgctcgatgaagcttcggtaacaggtacggccaatattttgatggccgcc
gttttggccgaaggaaaaacgaccatttacaacgcggcctgtgagccttatttgcaacag
ctgtgtaaaatgttgaaccgtatgggcgccaagatttccggtgtaggctcgaacctattg
gaaattgagggggtagaatccttagggggaacggatcataccatgcttcccgatatgatc
gaaataggaagctggatcggcctcgccgctatgaccaaaagcgaattgacgattaagaac
gtaagttggaacgacctaggacaaattcccactgtcttcagaaagttgggcattaccttg
gaaaagaagggcgatgatatctttattcccgcacataccaacggatacgaaatacagaat
tatatcgatggctccattttgaccatagccgatgcgccttggccgggactcactcccgat
ctattgagtattatcttggtagtggccacccaggccaaaggtgaagtgctgatccatcaa
aaaatgtttgaaagccgtttgttctttgtggacaaacttatcgacatgggcgccaagatc
attctttgcgatccacaccgcgccacggtaatcggccacgattttaaatcgaccttaaag
gctacgaccatggtgtctcccgatattagggcaggggtttccttgttgatagccgcacta
tccgcaaagggtacgtctaccattcacaatattgaacagatcgatcgtggatacgaagac
atcgatacacgcttacgtgctatcggcgccaagatttcccgagtataa

DBGET integrated database retrieval system