KEGG   Zobellia galactanivorans: zobellia_4105Help
Entry
zobellia_4105     CDS       T01586                                 

Gene name
folE2
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
zga  Zobellia galactanivorans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zga00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4818540..4819139
Genome map
AA seq 199 aa AA seqDB search
MAPYRNLEEYDLEITSEVKDRFSKIIDGIGEDVTREGLVKTPERAAKAMLFLTQGYQQDA
VEILEGAMFKEDYDDMVIIKDIELYSLCEHHMLPFFGKAHVAYIPNGHIVGLSKIPRVVD
VFARRLQVQERLTHDILECINNTLKPKGVAVVIEASHMCMMMRGVQKQNSVTTTSGFRGQ
FEKIETRNEFLKLISSDLS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcaccctatagaaatttagaagaatatgatttggaaattacttcggaagtcaaagac
cgattttcaaaaattatcgatggaataggggaggacgttactcgcgaaggattggtaaaa
actcccgaaagagcggccaaggcgatgcttttccttacccagggataccaacaggatgcc
gttgagattcttgaaggggcgatgttcaaggaagattatgacgatatggtcattatcaag
gacattgaactgtattcgctctgcgagcaccacatgctgcctttctttggcaaggcacac
gtggcctacattcctaacggacatattgtggggctaagtaaaatcccaagggtggtcgat
gtttttgcccgtcgccttcaagtacaggaacgtttgacccatgatattctcgaatgcatc
aacaacacccttaagccaaaaggtgtggcagtggttattgaagcatcacatatgtgcatg
atgatgcgtggggttcaaaaacaaaattccgtgacaaccacctctggctttcgtggacag
ttcgaaaaaatcgagacccgaaacgagtttttaaaactgatcagttccgatttgtcttaa

DBGET integrated database retrieval system