KEGG   Zobellia galactanivorans: zobellia_4105Help
Entry
zobellia_4105     CDS       T01586                                 

Gene name
folE2
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
zga  Zobellia galactanivorans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    zobellia_4105 (folE2)
Enzymes [BR:zga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     zobellia_4105 (folE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4818540..4819139
Genome map
AA seq 199 aa AA seqDB search
MAPYRNLEEYDLEITSEVKDRFSKIIDGIGEDVTREGLVKTPERAAKAMLFLTQGYQQDA
VEILEGAMFKEDYDDMVIIKDIELYSLCEHHMLPFFGKAHVAYIPNGHIVGLSKIPRVVD
VFARRLQVQERLTHDILECINNTLKPKGVAVVIEASHMCMMMRGVQKQNSVTTTSGFRGQ
FEKIETRNEFLKLISSDLS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcaccctatagaaatttagaagaatatgatttggaaattacttcggaagtcaaagac
cgattttcaaaaattatcgatggaataggggaggacgttactcgcgaaggattggtaaaa
actcccgaaagagcggccaaggcgatgcttttccttacccagggataccaacaggatgcc
gttgagattcttgaaggggcgatgttcaaggaagattatgacgatatggtcattatcaag
gacattgaactgtattcgctctgcgagcaccacatgctgcctttctttggcaaggcacac
gtggcctacattcctaacggacatattgtggggctaagtaaaatcccaagggtggtcgat
gtttttgcccgtcgccttcaagtacaggaacgtttgacccatgatattctcgaatgcatc
aacaacacccttaagccaaaaggtgtggcagtggttattgaagcatcacatatgtgcatg
atgatgcgtggggttcaaaaacaaaattccgtgacaaccacctctggctttcgtggacag
ttcgaaaaaatcgagacccgaaacgagtttttaaaactgatcagttccgatttgtcttaa

DBGET integrated database retrieval system