KEGG   Zobellia galactanivorans: ZOBELLIA_4128Help
Entry
ZOBELLIA_4128     CDS       T01586                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
zga  Zobellia galactanivorans
Pathway
zga00860  Porphyrin and chlorophyll metabolism
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ZOBELLIA_4128
Enzymes [BR:zga01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ZOBELLIA_4128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Mg_chelatase Sigma54_activat AAA_3 LIX1
Motif
Other DBs
NCBI-ProteinID: CAZ98263
UniProt: G0L2X9
Position
4844221..4845690
Genome map
AA seq 489 aa AA seqDB search
MKLDYKNINTLGQLKAAGYQTKSIKDELRDNLIEKIKKGEETFTGVWGYEDSVIPELERA
ILSRHNINLLGLRGQAKTRLAHLMVNLLDEYIPVVEGSEINDDPTKPMSRYAMELIKEKG
VDTPISWLHRDERFAEKLATPDVTVADLIGDVDPIKAANLKLSYADDRVIHFGMIPRANR
CIFVINELPDLQARIQVSLFNILEEGDIQIRGFKLRLPLDIQFVFTANPEDYTNRGSIVT
PLKDRIGSQILTHYPDDIETARKITEQEARLDERQTNSVYVPDIAKDLLEQVIFEARESE
YVDAKSGVSARTSITAFENLLSTAERRALLTDAESTMVRLSDFMGIIPAITGKIELVYEG
EQEGADGVAEILIDDAVKRLFPKYFPAINKLERKDAQTPYDGLLSWFFQGEGFELLDEFT
DEEYKRSLDAIPELNQLIKEHQPDFPKADVYFLKELILWGLVSHNKLSKNRFSEGYQFKD
LYGSYIDKL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagattataaaaatataaataccctaggccagctaaaagctgccgggtaccag
accaagagtatcaaagatgagttgcgggacaaccttatcgaaaaaataaagaaaggagaa
gagacctttacgggagtttggggttatgaagattcggtgattcccgaattggaaagggcc
attctgtctcgtcacaacatcaatttacttgggttgcgcggacaggcaaaaacccgtttg
gcccacctaatggtgaatttattggatgaatacattcccgtagtggaaggttcagaaatc
aatgacgaccctacaaagcctatgtctagatatgccatggagcttatcaaggaaaaaggg
gttgataccccaatttcttggctgcacagggatgagcgttttgccgaaaaattggcgaca
cccgatgttaccgtggccgatttgataggtgatgtcgaccccataaaggcggcaaacctt
aaattatcttatgccgatgacagggtgatccattttggaatgatcccccgggccaaccgt
tgtatcttcgtaatcaacgaactacccgaccttcaggctaggattcaggtgtctttattc
aatattttagaggagggtgatatacaaattcgtggatttaaactgcgattgcccctagat
attcaatttgtgtttacggcaaaccccgaggattataccaacaggggaagcattgtaacc
cctttgaaagataggatcggctcacagatcttgacccattatcccgacgatattgaaacg
gcgagaaaaattacggaacaagaagcccgtctagatgaacgtcaaacaaattccgtctac
gttcccgatattgccaaggacttgttagagcaagtgatttttgaggccagggagagcgaa
tatgtagatgccaagagcggggtaagtgcccgtacgagtattaccgcttttgaaaacctt
ttgagcactgccgaaagaagggccctattgaccgatgcggaaagtaccatggtgcgcttg
agcgattttatgggaatcattcccgctattaccggaaagatcgaactggtctatgaaggg
gagcaagaaggtgccgatggcgttgccgaaatactgatcgacgatgccgtaaaacgtttg
tttcccaaatattttcccgccattaacaaattggaaagaaaggatgcccaaacgccgtat
gacggacttctaagctggttctttcaaggggaaggctttgagcttttagatgagtttacc
gatgaggaatacaaacgtagtttggatgccattccagaattgaaccaattgataaaggaa
catcaacccgattttcccaaggcggatgtatatttcttaaaggaattgatcttatgggga
ctcgtatcacacaataaattgagtaaaaaccgattttcggaaggttaccagtttaaagac
ctttacggaagctatatcgataagctgtag

DBGET integrated database retrieval system