KEGG   Zobellia galactanivorans: zobellia_4128Help
Entry
zobellia_4128     CDS       T01586                                 

Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
zga  Zobellia galactanivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    zobellia_4128
Enzymes [BR:zga01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     zobellia_4128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4844221..4845690
Genome map
AA seq 489 aa AA seqDB search
MKLDYKNINTLGQLKAAGYQTKSIKDELRDNLIEKIKKGEETFTGVWGYEDSVIPELERA
ILSRHNINLLGLRGQAKTRLAHLMVNLLDEYIPVVEGSEINDDPTKPMSRYAMELIKEKG
VDTPISWLHRDERFAEKLATPDVTVADLIGDVDPIKAANLKLSYADDRVIHFGMIPRANR
CIFVINELPDLQARIQVSLFNILEEGDIQIRGFKLRLPLDIQFVFTANPEDYTNRGSIVT
PLKDRIGSQILTHYPDDIETARKITEQEARLDERQTNSVYVPDIAKDLLEQVIFEARESE
YVDAKSGVSARTSITAFENLLSTAERRALLTDAESTMVRLSDFMGIIPAITGKIELVYEG
EQEGADGVAEILIDDAVKRLFPKYFPAINKLERKDAQTPYDGLLSWFFQGEGFELLDEFT
DEEYKRSLDAIPELNQLIKEHQPDFPKADVYFLKELILWGLVSHNKLSKNRFSEGYQFKD
LYGSYIDKL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagattataaaaatataaataccctaggccagctaaaagctgccgggtaccag
accaagagtatcaaagatgagttgcgggacaaccttatcgaaaaaataaagaaaggagaa
gagacctttacgggagtttggggttatgaagattcggtgattcccgaattggaaagggcc
attctgtctcgtcacaacatcaatttacttgggttgcgcggacaggcaaaaacccgtttg
gcccacctaatggtgaatttattggatgaatacattcccgtagtggaaggttcagaaatc
aatgacgaccctacaaagcctatgtctagatatgccatggagcttatcaaggaaaaaggg
gttgataccccaatttcttggctgcacagggatgagcgttttgccgaaaaattggcgaca
cccgatgttaccgtggccgatttgataggtgatgtcgaccccataaaggcggcaaacctt
aaattatcttatgccgatgacagggtgatccattttggaatgatcccccgggccaaccgt
tgtatcttcgtaatcaacgaactacccgaccttcaggctaggattcaggtgtctttattc
aatattttagaggagggtgatatacaaattcgtggatttaaactgcgattgcccctagat
attcaatttgtgtttacggcaaaccccgaggattataccaacaggggaagcattgtaacc
cctttgaaagataggatcggctcacagatcttgacccattatcccgacgatattgaaacg
gcgagaaaaattacggaacaagaagcccgtctagatgaacgtcaaacaaattccgtctac
gttcccgatattgccaaggacttgttagagcaagtgatttttgaggccagggagagcgaa
tatgtagatgccaagagcggggtaagtgcccgtacgagtattaccgcttttgaaaacctt
ttgagcactgccgaaagaagggccctattgaccgatgcggaaagtaccatggtgcgcttg
agcgattttatgggaatcattcccgctattaccggaaagatcgaactggtctatgaaggg
gagcaagaaggtgccgatggcgttgccgaaatactgatcgacgatgccgtaaaacgtttg
tttcccaaatattttcccgccattaacaaattggaaagaaaggatgcccaaacgccgtat
gacggacttctaagctggttctttcaaggggaaggctttgagcttttagatgagtttacc
gatgaggaatacaaacgtagtttggatgccattccagaattgaaccaattgataaaggaa
catcaacccgattttcccaaggcggatgtatatttcttaaaggaattgatcttatgggga
ctcgtatcacacaataaattgagtaaaaaccgattttcggaaggttaccagtttaaagac
ctttacggaagctatatcgataagctgtag

DBGET integrated database retrieval system