KEGG   Zobellia galactanivorans: zobellia_474Help
Entry
zobellia_474      CDS       T01586                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
zga  Zobellia galactanivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    zobellia_474 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    zobellia_474 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    zobellia_474 (thrC)
Enzymes [BR:zga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     zobellia_474 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
613910..615205
Genome map
AA seq 431 aa AA seqDB search
MNFYSLNKKAPEVSFKDAVIKGIAPDKGLYFPERIEPLPARFFEHIEDLTDHEIAFNAIH
QFVSDEIPNDRLREIIAKVLDFDFPVVEIEENVSTLELFHGPTMAFKDVGARFMANCLGY
FSEGEKQDVTVLVATSGDTGGAVANGFLGVEGVRVVILYPNGKVSDIQERQLTTLGQNIT
ALRVDGTFDDCQKMVKTAFLDGDLLEKMQLTSANSINVARWLPQLFYFLFAYKQAKAKGK
EIVFSIPSGNFGNICAGMVAQRLGMPVKHFIAATNVNDTVPEFMRTKEYTPKPSTPTISN
AMDVGDPSNFIRIRHLYQDNFEALQKNLSSYAFSDAETRETMKKVYTKSGYITDPHGAVG
YLGLKKYQETHPDCYGIFLETAHPVKFLDVVEDTIGRSVDIPEQIKQVMDKEKKSISIKE
YDELKQYLLNR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttatagcctaaataaaaaagcccccgaagtttcgtttaaagatgcggtaatc
aaaggaatcgctcccgataaaggactgtattttcctgagcggatagagccccttcccgcg
cgtttctttgaacatatcgaagatttgaccgatcatgaaattgcattcaatgccattcac
caatttgtatccgatgaaattcccaacgacaggctccgcgaaattattgccaaggtcctt
gactttgactttccggtagttgaaattgaggaaaacgtatcgaccttagaactttttcac
ggtcccaccatggcctttaaagatgtcggcgcacgctttatggccaattgccttggctat
ttttcagaaggggaaaagcaagatgtaaccgtattggtagccacttcaggtgacaccggt
ggcgccgttgccaatggttttttaggcgtggaaggcgttcgtgtggtcattctctacccg
aacggaaaagtaagcgatattcaagaacgacagctgaccaccttgggccagaatataacc
gcccttagagtagacggcacctttgacgactgtcaaaaaatggtaaagaccgctttctta
gacggagaccttctggaaaaaatgcaattgacatcggccaattccatcaatgtggcgcgc
tggctgccccaattgttctattttttgtttgcctataaacaagcgaaagcaaagggaaag
gaaatcgttttctccatccccagcggtaacttcggaaacatctgtgccggtatggtagcc
caacgtctaggcatgcccgtaaaacactttattgccgccaccaatgttaacgacaccgtg
cccgagttcatgagaacgaaggaatacaccccaaaaccctctacaccaaccatctcaaat
gccatggatgtgggcgacccaagtaatttcattcgcatcagacatttgtaccaagataat
tttgaagcgttacagaaaaacctctcttcgtacgccttctccgatgcggaaaccagggaa
accatgaaaaaagtatacactaaaagcggctatattaccgacccccatggggctgtcggt
tatttagggttgaagaaataccaagaaacgcatcccgattgttacggtatctttttagag
accgcacatcccgtaaaatttttggatgtggtggaagacaccatcggtcggtcggtcgat
attcccgaacagatcaaacaggtaatggacaaagaaaagaagtccatttccataaaggaa
tacgacgagctcaaacagtatctattgaaccgctaa

DBGET integrated database retrieval system