KEGG   Zobellia galactanivorans: zobellia_4750Help
Entry
zobellia_4750     CDS       T01586                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
zga  Zobellia galactanivorans
Brite
Enzymes [BR:zga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     zobellia_4750 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5490855..5491469)
Genome map
AA seq 204 aa AA seqDB search
MRNKLAETLVAKGISNNNVLNAIRTIPRHLFMDSSFEGHAYQDKAFPIAADQTISQPYTV
AFQSQLLEVKPEQKILEIGTGSGYQTAVLLLLKARVYTIERQLELFKKTKIFFGKMGYRP
KKMIFGDGYKGLPDQAPYDGIIVTAGAPEVPKALMSQLKIGGRLVIPVGSDEQIMTLFVR
KSEKEFEKTEYGSFRFVPLLEDKN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacaagctggccgaaacattggtagctaagggcatttcgaacaataatgtgttg
aatgccatacgtaccattcctaggcatttgtttatggacagcagttttgaaggacatgcc
taccaagacaaggcttttcccattgctgccgatcaaactatttcgcaaccgtataccgtg
gcttttcagtcgcagttacttgaggtaaaaccagaacagaagattcttgaaataggaacc
ggaagcggatatcaaactgcagtattgttgcttttaaaggcaagggtgtacactatcgag
cgtcaattggagctatttaagaaaaccaagattttctttggaaaaatgggctatcgccct
aaaaagatgattttcggtgatggttataaaggcttgcccgatcaggcgccttacgatggg
attatcgtaaccgccggtgcccctgaagtacctaaagcccttatgagccagttaaaaatc
ggaggtaggttggtgattcccgtaggaagcgacgaacagattatgaccctttttgtacga
aagtcagaaaaggaatttgaaaagacggaatacggatccttccgctttgtaccgttgttg
gaagacaagaactag

DBGET integrated database retrieval system