KEGG   Zobellia galactanivorans: zobellia_600Help
Entry
zobellia_600      CDS       T01586                                 

Gene name
bfmBAB
Definition
dihydrolipoyllysine-residue (2-methylpropanoyl) transferase, E2 component (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
zga  Zobellia galactanivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    zobellia_600 (bfmBAB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    zobellia_600 (bfmBAB)
  Amino acid metabolism
   00310 Lysine degradation
    zobellia_600 (bfmBAB)
Enzymes [BR:zga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     zobellia_600 (bfmBAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(736633..737985)
Genome map
AA seq 450 aa AA seqDB search
MSKFELKLPRMGESVAEATLTSWLKEVGDTIELDEPIFEIATDKVDSEVPSEVEGVLVER
FFEVDDVIKVGETVAIIETEQSDNTEAVVVDKTSDKVEESAAMVEETVKVAKEVASAPVH
QAPKAVSGERFYSPLVKNIAKQEGISMDELDTIKGTGNDGRVTKNDILDYLKNGRVKAEE
PAAAVATEVKKEAPSVNSVQAVKEPVAAATIKQSVDAEVIPMSRMGKLIAKHMAESVSTS
AHVQSFIEVDVTNIVNWRNKVKADFEKREGEKLTFTPIFMEAVAKALKKYPMMNISVDGD
TVIKKKNINIGMAAALPDGNLIVPVIKNADQLNLVGMAKVVNDLAFRSKTNKLKPDEVQD
GTYTVTNVGTFGSVFGTPIINQPQVGILALGAIRKIPSVIETAEGDFIGIRSKMYLSHSY
DHRVVNGALGSMFAKAVADYLEGWDVDREI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtttgaactgaaattaccgagaatgggtgagagtgttgccgaggcaacgttg
acctcttggttgaaagaagttggggatactattgaattggacgagcctatttttgaaata
gccaccgacaaggtggattcggaggttcctagtgaggtggaaggtgttttggtagaaagg
ttctttgaggtagacgatgtgatcaaggttggggaaacggttgcgataatcgagaccgaa
cagtcggacaatacggaagctgtggttgtcgataagacaagcgataaagtagaggaatct
gcggctatggtagaggagacggtaaaagtggccaaggaagtggccagtgcacctgtccat
caagctccaaaggccgtatcgggagagcgcttttactcacccttggtgaaaaatatagcg
aaacaagaaggtatctcaatggacgaactcgataccattaaaggtacgggtaacgatgga
agggtcaccaaaaacgatattctcgattatttaaagaacggtagggtaaaagctgaagag
cctgctgctgcggtcgctacagaggtaaaaaaagaagccccttcagtgaattcggtgcaa
gcggtaaaagagccggttgcggcggctaccataaagcaatccgttgatgcggaggtcatt
cccatgtcgcgtatggggaaattgatagccaagcatatggccgagagcgtgtcgacttcg
gcgcatgtacagagttttatcgaggtagatgtgaccaatatcgtaaactggcgtaacaag
gttaaggcagattttgagaaaagggaaggtgaaaaactgacgtttacccccatctttatg
gaagctgtggccaaggcattgaaaaagtatcccatgatgaacatatctgtagatggcgat
acggttatcaaaaagaaaaatataaacattggtatggctgcggccctgccggacggtaac
cttatcgttccggtcataaaaaatgccgaccaattgaatttggtaggtatggccaaggtg
gtgaacgatttggcctttaggtcaaaaacgaataaattaaaacccgatgaggtgcaagac
ggtacctatacggtaaccaatgtcggaacctttggcagtgtgttcggtacgcctattatc
aatcagccgcaggtaggtattttggccttgggggcgattcggaagattccgtcggtaata
gagaccgccgaaggtgattttatagggattcgcagtaagatgtacctttcccatagctat
gatcatagggtggtaaacggggccttgggcagtatgttcgccaaggcggtggccgactac
ttggaaggttgggatgtagatagggaaatctag

DBGET integrated database retrieval system