KEGG   Zobellia galactanivorans: zobellia_600Help
Entry
zobellia_600      CDS       T01586                                 

Gene name
bfmBAB
Definition
dihydrolipoyllysine-residue (2-methylpropanoyl) transferase, E2 component (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
zga  Zobellia galactanivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:zga01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:zga00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:zga00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(736633..737985)
Genome map
AA seq 450 aa AA seqDB search
MSKFELKLPRMGESVAEATLTSWLKEVGDTIELDEPIFEIATDKVDSEVPSEVEGVLVER
FFEVDDVIKVGETVAIIETEQSDNTEAVVVDKTSDKVEESAAMVEETVKVAKEVASAPVH
QAPKAVSGERFYSPLVKNIAKQEGISMDELDTIKGTGNDGRVTKNDILDYLKNGRVKAEE
PAAAVATEVKKEAPSVNSVQAVKEPVAAATIKQSVDAEVIPMSRMGKLIAKHMAESVSTS
AHVQSFIEVDVTNIVNWRNKVKADFEKREGEKLTFTPIFMEAVAKALKKYPMMNISVDGD
TVIKKKNINIGMAAALPDGNLIVPVIKNADQLNLVGMAKVVNDLAFRSKTNKLKPDEVQD
GTYTVTNVGTFGSVFGTPIINQPQVGILALGAIRKIPSVIETAEGDFIGIRSKMYLSHSY
DHRVVNGALGSMFAKAVADYLEGWDVDREI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtttgaactgaaattaccgagaatgggtgagagtgttgccgaggcaacgttg
acctcttggttgaaagaagttggggatactattgaattggacgagcctatttttgaaata
gccaccgacaaggtggattcggaggttcctagtgaggtggaaggtgttttggtagaaagg
ttctttgaggtagacgatgtgatcaaggttggggaaacggttgcgataatcgagaccgaa
cagtcggacaatacggaagctgtggttgtcgataagacaagcgataaagtagaggaatct
gcggctatggtagaggagacggtaaaagtggccaaggaagtggccagtgcacctgtccat
caagctccaaaggccgtatcgggagagcgcttttactcacccttggtgaaaaatatagcg
aaacaagaaggtatctcaatggacgaactcgataccattaaaggtacgggtaacgatgga
agggtcaccaaaaacgatattctcgattatttaaagaacggtagggtaaaagctgaagag
cctgctgctgcggtcgctacagaggtaaaaaaagaagccccttcagtgaattcggtgcaa
gcggtaaaagagccggttgcggcggctaccataaagcaatccgttgatgcggaggtcatt
cccatgtcgcgtatggggaaattgatagccaagcatatggccgagagcgtgtcgacttcg
gcgcatgtacagagttttatcgaggtagatgtgaccaatatcgtaaactggcgtaacaag
gttaaggcagattttgagaaaagggaaggtgaaaaactgacgtttacccccatctttatg
gaagctgtggccaaggcattgaaaaagtatcccatgatgaacatatctgtagatggcgat
acggttatcaaaaagaaaaatataaacattggtatggctgcggccctgccggacggtaac
cttatcgttccggtcataaaaaatgccgaccaattgaatttggtaggtatggccaaggtg
gtgaacgatttggcctttaggtcaaaaacgaataaattaaaacccgatgaggtgcaagac
ggtacctatacggtaaccaatgtcggaacctttggcagtgtgttcggtacgcctattatc
aatcagccgcaggtaggtattttggccttgggggcgattcggaagattccgtcggtaata
gagaccgccgaaggtgattttatagggattcgcagtaagatgtacctttcccatagctat
gatcatagggtggtaaacggggccttgggcagtatgttcgccaaggcggtggccgactac
ttggaaggttgggatgtagatagggaaatctag

DBGET integrated database retrieval system