KEGG   Zobellia galactanivorans: zobellia_670Help
Entry
zobellia_670      CDS       T01586                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
zga  Zobellia galactanivorans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    zobellia_670 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    zobellia_670 (trpC)
Enzymes [BR:zga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     zobellia_670 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824932..825714
Genome map
AA seq 260 aa AA seqDB search
MNILDKIVVDKRKETDLRKSLIPVSQLENSVLFARETVSLGKALRNSSTGIIAEHKRRSP
SKSEINQGLNVQDVARGYENAGVCGMSVLTDGKYFGGSLDDLLLARASVRLPLLRKEFII
DEYQIIEARAHGADVILLIAAILSKEEIKTFSELAKSLDLDVLLEVHNEAELQKSIMPSL
DMLGVNNRNLKTFEVSLDTSKSLSKLIPDEFVKVSESGISSIEAIKNLKPYGYQGFLIGE
NFMKTDNPGENAKEFIKQLS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctagacaaaatagtagtcgacaaacgcaaggaaacagacttaagaaagtcg
cttatccccgtttcccaattggaaaattcggtcttgttcgcacgtgaaacggtttctttg
ggcaaggccctgcgcaacagctcaaccggtatcattgccgagcacaagcgacgttcgccc
tcaaaatcggaaatcaaccaaggcctgaacgttcaagacgtagcccgcgggtacgaaaat
gcaggcgtctgtggcatgtccgttttaaccgacgggaaatactttggcggttcgttggac
gatctgttattggcccgtgcttccgtacgcctacccttattgcgaaaagagtttattata
gacgaatatcaaattatagaggccagggcccatggtgccgatgtgatccttttgatcgcc
gctattttatcgaaggaggaaataaaaaccttttcggagttggccaaaagcctagaccta
gatgtactgttagaggtacacaacgaagccgaactacagaaaagcatcatgcccagcctc
gacatgctgggcgtaaacaatcgaaacctaaagacttttgaggtgagtctagatactagc
aaatcgctttcaaaactcattccggacgagttcgtaaaagtatcggaaagcggaatcagc
tcaatagaggccattaaaaatttaaagccttacgggtatcaagggtttttgatcggggaa
aattttatgaaaacggacaatcccggcgaaaacgccaaggaatttatcaaacaattgtcg
taa

DBGET integrated database retrieval system