KEGG   Zobellia galactanivorans: ZOBELLIA_672Help
Entry
ZOBELLIA_672      CDS       T01586                                 

Gene name
trpB1
Definition
(GenBank) Tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
zga  Zobellia galactanivorans
Pathway
zga00260  Glycine, serine and threonine metabolism
zga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01130  Biosynthesis of antibiotics
zga01230  Biosynthesis of amino acids
Module
zga_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZOBELLIA_672 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZOBELLIA_672 (trpB1)
Enzymes [BR:zga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZOBELLIA_672 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAZ94738
UniProt: G0L9Q3
Position
826479..827663
Genome map
AA seq 394 aa AA seqDB search
MKTYQADEKGYYGEFGGAYIPEMLYPNTEELRQNYIRIMEEPSFKKEFDQLLKDYIGRPT
PLYFADRLSRKYNTKIYLKREDLCHTGAHKVNNTIGQILMAKKLGKNRIIAETGAGQHGV
ATATVCALMGIECIVYMGEIDIARQAPNVARMKMLGAEVRPALSGSRTLKDATNEAIRDW
INNPVDTHYIIGSVVGPHPYPDMVARFQSVISEEIKWQLKEKEGRENPDYVVACVGGGSN
AAGAFYHYLDIPEVGIIAVEAAGKGIDSGESAATSALGKVGIIHGSKTLLMQTNDGQITE
PYSISAGLDYPGVGPMHANLFASGRGEFISITDDDAMNAGLLLSKMEGIIPAIESSHALA
ILEHRKFKPEDIVVINLSGRGDKDLNNYIEYFNL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctatcaagcggacgaaaaaggatattacggggagtttggcggtgcctatatt
cctgaaatgctataccccaataccgaggaacttcggcagaattatatccgtatcatggaa
gagccttcctttaaaaaggaatttgaccaattgctcaaagattatataggacgccctacc
ccgctctattttgcagatcggctttcaagaaaatacaacactaaaatctacctgaagcgc
gaagatctttgccataccggtgcgcacaaggtcaacaataccattgggcagatcctaatg
gccaaaaaattgggcaagaacaggatcattgccgaaacgggtgccggccaacatggggtg
gctaccgcaacggtctgtgcccttatgggcattgagtgcatcgtttacatgggcgaaata
gacattgcccgtcaagctcccaacgtggcccgtatgaagatgttgggtgccgaggtcaga
cctgcgctttcgggcagtagaaccttaaaagatgccaccaacgaagccattcgcgactgg
atcaacaaccctgtagacacccattacattatcggtagtgtggtcgggccgcatccctac
cccgatatggtagcacggtttcagtcggtaatctcggaagagatcaaatggcagttgaaa
gaaaaggaaggacgggaaaatcccgattacgtagtggcctgtgtgggcgggggaagtaat
gcggcgggagccttctatcattacctagatatcccggaagtaggcatcatagccgttgaa
gccgccggaaaaggaattgacagtggcgaaagtgcagccacctcggccttgggaaaagtg
ggaatcattcacggtagtaaaaccttgttaatgcagaccaatgacggacaaattaccgag
ccctactccatttccgcaggattggattatcccggggtcggacccatgcatgccaattta
ttcgcatcgggccgcggggagtttatttccattaccgatgacgatgccatgaacgccggc
ttgctcttgtctaaaatggaaggtattatcccggctattgaatcttcgcatgcactggcc
atcttggaacaccgaaagttcaagcccgaagatatcgtagtgatcaacctatcggggcgt
ggcgataaagacctcaacaactacatcgaatattttaatctataa

DBGET integrated database retrieval system