KEGG   Zobellia galactanivorans: ZOBELLIA_672Help
Entry
ZOBELLIA_672      CDS       T01586                                 

Gene name
trpB1
Definition
(GenBank) Tryptophan synthase beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
zga  Zobellia galactanivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZOBELLIA_672 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZOBELLIA_672 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZOBELLIA_672 (trpB1)
Enzymes [BR:zga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZOBELLIA_672 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
826479..827663
Genome map
AA seq 394 aa AA seqDB search
MKTYQADEKGYYGEFGGAYIPEMLYPNTEELRQNYIRIMEEPSFKKEFDQLLKDYIGRPT
PLYFADRLSRKYNTKIYLKREDLCHTGAHKVNNTIGQILMAKKLGKNRIIAETGAGQHGV
ATATVCALMGIECIVYMGEIDIARQAPNVARMKMLGAEVRPALSGSRTLKDATNEAIRDW
INNPVDTHYIIGSVVGPHPYPDMVARFQSVISEEIKWQLKEKEGRENPDYVVACVGGGSN
AAGAFYHYLDIPEVGIIAVEAAGKGIDSGESAATSALGKVGIIHGSKTLLMQTNDGQITE
PYSISAGLDYPGVGPMHANLFASGRGEFISITDDDAMNAGLLLSKMEGIIPAIESSHALA
ILEHRKFKPEDIVVINLSGRGDKDLNNYIEYFNL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctatcaagcggacgaaaaaggatattacggggagtttggcggtgcctatatt
cctgaaatgctataccccaataccgaggaacttcggcagaattatatccgtatcatggaa
gagccttcctttaaaaaggaatttgaccaattgctcaaagattatataggacgccctacc
ccgctctattttgcagatcggctttcaagaaaatacaacactaaaatctacctgaagcgc
gaagatctttgccataccggtgcgcacaaggtcaacaataccattgggcagatcctaatg
gccaaaaaattgggcaagaacaggatcattgccgaaacgggtgccggccaacatggggtg
gctaccgcaacggtctgtgcccttatgggcattgagtgcatcgtttacatgggcgaaata
gacattgcccgtcaagctcccaacgtggcccgtatgaagatgttgggtgccgaggtcaga
cctgcgctttcgggcagtagaaccttaaaagatgccaccaacgaagccattcgcgactgg
atcaacaaccctgtagacacccattacattatcggtagtgtggtcgggccgcatccctac
cccgatatggtagcacggtttcagtcggtaatctcggaagagatcaaatggcagttgaaa
gaaaaggaaggacgggaaaatcccgattacgtagtggcctgtgtgggcgggggaagtaat
gcggcgggagccttctatcattacctagatatcccggaagtaggcatcatagccgttgaa
gccgccggaaaaggaattgacagtggcgaaagtgcagccacctcggccttgggaaaagtg
ggaatcattcacggtagtaaaaccttgttaatgcagaccaatgacggacaaattaccgag
ccctactccatttccgcaggattggattatcccggggtcggacccatgcatgccaattta
ttcgcatcgggccgcggggagtttatttccattaccgatgacgatgccatgaacgccggc
ttgctcttgtctaaaatggaaggtattatcccggctattgaatcttcgcatgcactggcc
atcttggaacaccgaaagttcaagcccgaagatatcgtagtgatcaacctatcggggcgt
ggcgataaagacctcaacaactacatcgaatattttaatctataa

DBGET integrated database retrieval system