KEGG   Zobellia galactanivorans: ZOBELLIA_673Help
Entry
ZOBELLIA_673      CDS       T01586                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zga  Zobellia galactanivorans
Pathway
zga00260  Glycine, serine and threonine metabolism
zga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zga01100  Metabolic pathways
zga01110  Biosynthesis of secondary metabolites
zga01130  Biosynthesis of antibiotics
zga01230  Biosynthesis of amino acids
Module
zga_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZOBELLIA_673 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZOBELLIA_673 (trpA)
Enzymes [BR:zga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZOBELLIA_673 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth RRM_7 DMRL_synthase CoA_binding_3 WD40_3 HMGL-like
Motif
Other DBs
NCBI-ProteinID: CAZ94739
UniProt: G0L1I9
Position
827755..828519
Genome map
AA seq 254 aa AA seqDB search
MGNRINKKLKEEGKLLSIYFTAGYPKLGDTVEIIQQLEKNGVDMIEIGLPFSDPLADGPT
IQQSSTAALKNGMTTEILFDQLKDIRQSVSIPLIIMGYFNPMLQYGVEAFCKKCQEIGID
GLIIPDLPVDVYHEEYQETFEKYGLINVFLITPQTSEKRIRFIDSVSNGFIYMVSSASVT
GAQSGFGDAQQAYFQRIADMNLKNPQIVGFGISNSETFEQATKSAKGAIIGSAFIKHLNG
HGVDGIDKFIETIR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatagaatcaacaaaaaactgaaggaggaaggcaaattgctttccatctatttt
acggccggctatcccaaactgggcgacaccgtagaaatcatacagcaattggagaaaaac
ggcgtcgatatgatcgaaataggcctcccgttcagtgatcccctggccgacggccccacc
attcaacaaagttccacggcggcccttaaaaacggcatgacgaccgaaattcttttcgac
caactgaaagatatccgccaatcggtttccattccgcttattatcatgggctactttaac
cccatgcttcaatacggcgtagaggccttctgtaaaaaatgccaggaaattggtatagac
ggactcatcattcccgatctgccggtagatgtctatcatgaagaataccaagagaccttt
gaaaaatacggcctgatcaatgtattcttgataaccccacagacttccgagaaacgcatc
cggtttatagattcggtttcgaacggattcatttacatggtaagctcggctagtgttacc
ggggcacaatcgggtttcggcgatgcccagcaagcctattttcaacgcattgccgatatg
aacctaaaaaatccccaaatcgtaggtttcggcatcagcaattcagaaactttcgaacag
gctacaaaatcggccaaaggggccattatcggttcggcctttatcaaacatttaaacggt
catggcgtggatggaattgacaagttcatcgaaaccatccgctag

DBGET integrated database retrieval system