KEGG   Zobellia galactanivorans: ZOBELLIA_673Help
Entry
ZOBELLIA_673      CDS       T01586                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zga  Zobellia galactanivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZOBELLIA_673 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZOBELLIA_673 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZOBELLIA_673 (trpA)
Enzymes [BR:zga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZOBELLIA_673 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
827755..828519
Genome map
AA seq 254 aa AA seqDB search
MGNRINKKLKEEGKLLSIYFTAGYPKLGDTVEIIQQLEKNGVDMIEIGLPFSDPLADGPT
IQQSSTAALKNGMTTEILFDQLKDIRQSVSIPLIIMGYFNPMLQYGVEAFCKKCQEIGID
GLIIPDLPVDVYHEEYQETFEKYGLINVFLITPQTSEKRIRFIDSVSNGFIYMVSSASVT
GAQSGFGDAQQAYFQRIADMNLKNPQIVGFGISNSETFEQATKSAKGAIIGSAFIKHLNG
HGVDGIDKFIETIR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatagaatcaacaaaaaactgaaggaggaaggcaaattgctttccatctatttt
acggccggctatcccaaactgggcgacaccgtagaaatcatacagcaattggagaaaaac
ggcgtcgatatgatcgaaataggcctcccgttcagtgatcccctggccgacggccccacc
attcaacaaagttccacggcggcccttaaaaacggcatgacgaccgaaattcttttcgac
caactgaaagatatccgccaatcggtttccattccgcttattatcatgggctactttaac
cccatgcttcaatacggcgtagaggccttctgtaaaaaatgccaggaaattggtatagac
ggactcatcattcccgatctgccggtagatgtctatcatgaagaataccaagagaccttt
gaaaaatacggcctgatcaatgtattcttgataaccccacagacttccgagaaacgcatc
cggtttatagattcggtttcgaacggattcatttacatggtaagctcggctagtgttacc
ggggcacaatcgggtttcggcgatgcccagcaagcctattttcaacgcattgccgatatg
aacctaaaaaatccccaaatcgtaggtttcggcatcagcaattcagaaactttcgaacag
gctacaaaatcggccaaaggggccattatcggttcggcctttatcaaacatttaaacggt
catggcgtggatggaattgacaagttcatcgaaaccatccgctag

DBGET integrated database retrieval system