KEGG   Candidatus Zinderia insecticola: ZICARI_087Help
Entry
ZICARI_087        CDS       T01304                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zin  Candidatus Zinderia insecticola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZICARI_087 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZICARI_087 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZICARI_087 (trpA)
Enzymes [BR:zin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZICARI_087 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(84048..84836)
Genome map
AA seq 262 aa AA seqDB search
MLKIKNFFLNIKRKKKIFIIFIIPGDLNINLTIKFMHILIKTGIHVIEIGIPFSDPVAEG
IFIQKSSERILKFGISIKNILNFIKKFRKINKFTPLIFMGYMNTYNLLNKKIYIKKINNL
LINNFIIVDFPIEEYLILKNIIKKKNINQIFLISSNTFLKRIKRILNLSKCFIYYVSLKG
TTGSKNIFFNKIKKKIKIVKNNTNLPLMIGFGINKKNIKNIINFSDGIIIGSNFLKFIQN
LKKKNIFINIINYIKNIKLNLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaataaaaaatttttttttaaatataaaaagaaaaaaaaaaatatttataata
tttattattccaggagatttaaatattaatctaacaattaaatttatgcatattttaata
aaaacaggaatacatgtaatagaaataggaatacctttttcagatccagtagcagaagga
atatttatacaaaaatcttctgaaagaatattaaaatttggtatttctattaaaaatatt
ttaaattttataaaaaaatttagaaaaataaataaatttactccattaatatttatggga
tatatgaatacttataatttattaaataaaaaaatatatattaaaaaaattaataattta
ttaattaataattttataattgtagattttcctatagaagaatatttaatattaaaaaat
ataattaagaaaaaaaatataaatcaaatatttttaatttcttcaaatacttttttaaaa
agaataaaaagaattttaaatttaagtaaatgttttatatattatgtttctttaaaagga
actacaggttctaaaaatattttttttaataaaataaaaaaaaaaattaaaatagtaaaa
aataatactaatttacctttaatgattggttttggtataaataaaaaaaatattaaaaat
attataaatttttctgatggtataattataggaagtaattttttaaaatttattcaaaat
ttaaaaaaaaaaaatatatttataaacattataaattatattaaaaatataaaattaaat
ttactttaa

DBGET integrated database retrieval system