KEGG   Candidatus Zinderia insecticola: ZICARI_164Help
Entry
ZICARI_164        CDS       T01304                                 

Gene name
sucB
Definition
(RefSeq) putative 2-oxoglutarate dehydrogenase, E2 subunit
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
zin  Candidatus Zinderia insecticola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZICARI_164 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZICARI_164 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ZICARI_164 (sucB)
Enzymes [BR:zin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ZICARI_164 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
153190..154440
Genome map
AA seq 416 aa AA seqDB search
MKIKIKKIKVPQLSESTSNAIILKWHKKEGDYVNKEENLVDIETDKIVLEIKTKNNGFIK
KIKKNINEIVKTNETLCILEIKKINEDNKNNIKSNIKENIKENIEEEINSINNIDNISII
NNKNNKNYKKNKKDKNNKILMPSAKSLIINNNKINLNKINGTGKDKRIRKIDILKFIKKN
KKKILNKEINKMSKIRIEISKNLLKSKLKTVSLTTFNEVNMNKIIKIKKKYKNIFYEKYK
VNLGFMSFFVKAVTNSLIKFPIINSSIKKKKIINYKYYNIGIAINTNNGLIVPILHNTNL
MSIYKIEKKIDNFIYKANNNKLSLKNLKNGTFTITNGGIFGSILSTPIINYPQSSILGIH
SIQKKPIVKNNKIVIRPMTYLALSYDHRLIDGKDAILFLKSVKDLLENPIKLFLEI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaataaaaaaaataaaagttcctcaattatcagaatctacttctaatgcc
ataatattaaaatgacataaaaaagaaggtgattatgtaaataaagaagaaaatttagtt
gatatagaaactgataaaattgtattagaaattaaaactaaaaataatggttttataaaa
aaaataaaaaaaaatattaatgaaatagtaaaaacaaatgaaacattatgtattctagaa
ataaaaaaaattaatgaagataataaaaataatataaaaagtaatataaaagaaaatata
aaagagaatatagaagaggaaataaatagtataaataatatagataatatatctattata
aataataaaaataataaaaattataaaaaaaataaaaaagataaaaataataaaattctt
atgccatctgctaaaagtttaataataaataataataaaattaatttaaataaaataaat
ggtacaggtaaagataaaagaataagaaaaatagatattttaaaatttatcaaaaaaaat
aaaaaaaaaatattaaataaagaaataaataaaatgagtaaaataagaattgaaatttct
aaaaatttattaaaatcaaaattaaaaacagtttcattaacaacatttaatgaagtaaat
atgaataaaattattaaaattaaaaaaaaatataaaaatattttttatgaaaaatataaa
gttaatttaggatttatgtcattttttgttaaagcggtaactaattctttaataaaattt
ccaattataaattcaagtataaaaaaaaaaaaaataataaattataaatattataatata
ggaatagctattaatactaataatggattaatagtaccaattttacataatacaaattta
atgtcaatttataaaatagaaaaaaaaatagataattttatttataaagctaataataac
aaattatcattaaaaaatttaaaaaatggtacttttacaataacaaatggtggaattttt
ggttcaattttatctactcctattataaattatcctcaatcttcaatactaggaatacat
tcaatacaaaaaaaacctatagttaaaaataataaaatagttataagacctatgacttat
ttagcattatcttatgatcatagattaatagatggtaaagatgctatattatttctaaaa
tctgtaaaagatttattagaaaatccaataaaattatttttagaaatataa

DBGET integrated database retrieval system